DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and Hltf

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_001342026.1 Gene:Hltf MGIID:1196437 Length:1003 Species:Mus musculus

Alignment Length:1035 Identity:257/1036 (25%)
Similarity:421/1036 (41%) Gaps:270/1036 (26%)


  Fly    13 HKQSCSIQDQSSVPVPDSSGEINNWMEPEPVDSLELSGEYADNESAIFVSASEY--NEKKAQIDQ 75
            :.:..::|.:.:.|...::.::||           ::|....:......:|..|  :.|.||::.
Mouse    79 NNEMVALQREPNNPYDKNAIKVNN-----------VNGNQVGHIKREIAAAVAYIMDNKLAQVEG 132

  Fly    76 LV----QKILTMEQQQR--QLEENASETKELCDLKLHLEKLNARLEALGEFLDTLRLREDQQEIK 134
            :|    ....||.....  ..|||.:...|  .||.|..||....:.||..|:.           
Mouse   133 VVPFGASNTFTMPLYMTFWGKEENRNVVLE--QLKKHGFKLGPTPKTLGSSLEN----------- 184

  Fly   135 IEDNSELVDHTEQPKWSNLYSGLNRYRQKANHTAAQFYQHKSNIIDSLKTLYEPIQPRPAIDD-- 197
                          .|.:..:|.: |.:.| |.|.|.      ..|.|||.::.:......||  
Mouse   185 --------------AWGSGRAGPS-YSRPA-HVAVQM------TTDQLKTEFDKLFEDLKEDDRT 227

  Fly   198 LEKQPA-LLLVRLLKHQQSCLKWMQFRERQK----------------------------ISGGIL 233
            :|.:|| .:...||.||:..|.||..||..|                            :.||||
Mouse   228 VEMEPAEAIETPLLPHQKQALAWMIARENSKELPPFWEQRNDLYYNTITNFSVKERPENVHGGIL 292

  Fly   234 ADDMGLGKTLSMIALILAS----------------------EETKNR------KREE-------- 262
            ||||||||||:.||:||.:                      :||..|      |:|:        
Mouse   293 ADDMGLGKTLTAIAVILTNFDDGRPLLSKRGKKNHPGKEYKDETIKRRGSNMDKKEDGHSESSTC 357

  Fly   263 ----------KKKALTLKWTQEFNRVYCKEIRKISMFDDEEESGKEEEQYEPPEKRTCHVKTKKI 317
                      :|.:.||   .:.:.| |.:.||||:...|....:|.|..|.|:|....:|..::
Mouse   358 GEEPSISGTPEKSSCTL---SQLSSV-CPKRRKISVQYIESSDSEEIETSELPQKMKGKLKNVQL 418

  Fly   318 N-QFRILDDDDNDAGDKAVVEDE-----------QKDLLAKTPEPEVFSSDEEEEHLSNGRYPSA 370
            | :.|:       .|...|.||.           |:.:|.|.     .|..|..|....|....|
Mouse   419 NTKSRV-------KGSSKVKEDSKFALTFFASATQRKMLKKG-----MSMMECSEACDTGERTRA 471

  Fly   371 NTLVVCPMSVMCQWAHEVASKVAQNA-IRVLTFHGPNRHEIGIEAFRS-YDLVITSYNLVVNELK 433
             ||::||:||:..|..:....|.... :....::||:|  |...|:.| .|:::|:||::.::  
Mouse   472 -TLIICPLSVLSNWIDQFGQHVKSEVHLNFYVYYGPDR--IRDSAWLSKQDIILTTYNILTHD-- 531

  Fly   434 RYG--NTSPLFAVYWNRVILDEAHIIRNSKTNCCNSVCQLRAHCHWALTGTPVQNRGVDVFALLR 496
             ||  :.|||.::.|.||||||.|.|||.......:|.:|.|...|.|||||:||...|:::||.
Mouse   532 -YGTKDDSPLHSIKWLRVILDEGHAIRNPNAQQTKAVLELEAERRWVLTGTPIQNSLKDLWSLLS 595

  Fly   497 FVNVPNFQDLQQWKKNLNESML-----GHRRLNFIIKPLMLRRTKQKLQASGDMPALPSLKIELI 556
            |:.:..|.|.:.|.:.:...:.     |.|||..:||.:.|||||........:..||..|:.:.
Mouse   596 FLKLKPFIDREWWYRIIQRPVTTGDEGGLRRLQSLIKNITLRRTKTSKIKGKPVLELPERKVFIQ 660

  Fly   557 CVQLSKTEMAVYQILSAISKKIFTQFLLQREKGNSDLNYYSLERTPQFIAGHMSDERYNEIYERF 621
            .:.||:.|..:||.:              :.:|.:.:..|..|.|   :..|.:|          
Mouse   661 HITLSEEERKIYQSV--------------KNEGKAAIGRYFTEGT---VLAHYAD---------- 698

  Fly   622 LKSLGYNPGEKILGIYILVLLLRLRQFCCHPGLMIGMLRGALTAEDVQNVKVDASDVEGQLKMDV 686
                            :|.|||||||.|||..|:         ...:.:.....||...:|:..:
Mouse   699 ----------------VLGLLLRLRQICCHTHLL---------TNGMSSSGPSRSDTPEELRKML 738

  Fly   687 LAELDKFDETDSEDDCCDEEDST----------------------RRDGNFKLEVIKDEIKEENV 729
            :.::.....:.|:::|....||.                      ....:.|..:.::||..:|:
Mouse   739 IEKMKIILSSGSDEECAICLDSLTFPVITHCAHVFCKPCICQVIHSEQPHAKCPLCRNEIHGDNL 803

  Fly   730 PWDSGDDLPTASSFEDQLDSARALKLLNPQNPIFQFIRPSAKLKMVIDKLEELLT-GTNDKIIVT 793
            .....::|...|..|..::                 .:.|:|:..::..|.||.| ..|.|.:|.
Mouse   804 LECPPEELACDSDKESSME-----------------WKSSSKINALMHALIELRTKDPNIKSLVV 851

  Fly   794 SQWVSYLAIVRKRLQDLSWETLDFNGQLTAKEREIVLRDFNANNE---KRVLLLSLTAGGVGLNL 855
            ||:.::|:::...|:...:.....:|.:..|:|...::.|. |.|   ..::||||.||||||||
Mouse   852 SQFTTFLSLIETPLKASGFVFTRLDGSMAQKKRVESIQRFQ-NTEAGSPTIMLLSLKAGGVGLNL 915

  Fly   856 NVANHMLIVDLHWNPQLERQAQDRIYRYGQTKPTFIYRYMCQDTVEQRIKSLQDCKLEIA 915
            ..|:.:.::|..|||..|.|..||.:|.||.:...|.:::.:|:||:.:..:|:.|.::|
Mouse   916 CAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNTKRDLA 975

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 150/538 (28%)
DEXDc <372..483 CDD:238005 42/115 (37%)
HELICc 761..892 CDD:238034 44/135 (33%)
HltfNP_001342026.1 DNA binding. {ECO:0000250} 38..287 51/254 (20%)
HIRAN 60..153 CDD:312360 13/85 (15%)
HepA <472..1003 CDD:223627 153/580 (26%)
DEGH box 551..554 2/3 (67%)
RING-HC_HLTF 752..795 CDD:319423 4/43 (9%)
RING-HC finger (C3HC4-type) 754..794 CDD:319423 4/40 (10%)
Interaction with SP1 and SP3. {ECO:0000250} 919..1003 18/58 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3486
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2250
TreeFam 00.000 Not matched by this tool.
21.980

Return to query results.
Submit another query.