DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10445 and F19B2.5

Sequence 1:NP_001246974.1 Gene:CG10445 FlyBaseID:FBgn0037531 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_507886.1 Gene:F19B2.5 WormBaseID:WBGene00008944 Length:144 Species:Caenorhabditis elegans

Alignment Length:125 Identity:28/126 (22%)
Similarity:56/126 (44%) Gaps:19/126 (15%)


  Fly   418 YDLVITSYNLVVNELKRYGNTSPLFAVYWNRVILDEAHIIRNSKTNCCNSVCQLRAHCHWALTGT 482
            :.:|:|:::.:    |...|...|..:.:.|:|:.:|:.|.|:.|....::.||.|...|.|||.
 Worm    13 HSVVVTTFDTI----KTLMNFQTLQKISFERIIIYDAYPIDNTDTQRYKALRQLDATYRWVLTGN 73

  Fly   483 PVQNRGVDVFALLRFVNVPNFQDLQQWK---------KNLNESMLGHRRLNFIIKPLMLR 533
            .:|..      |..|:.:..:.|.|.|.         |..:|.....:::..::|.:.|:
 Worm    74 LLQQN------LANFLKLGEYGDDQLWDTQICPILEGKQCDEKTELSKKIENLLKSVELK 127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10445NP_001246974.1 SNF2_N 212..655 CDD:278600 28/126 (22%)
DEXDc <372..483 CDD:238005 18/65 (28%)
HELICc 761..892 CDD:238034
F19B2.5NP_507886.1 SNF2_N <3..>129 CDD:278600 28/126 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3486
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.