DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2678 and si:ch211-241e1.5

Sequence 1:NP_649750.1 Gene:CG2678 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001119897.1 Gene:si:ch211-241e1.5 ZFINID:ZDB-GENE-030131-6298 Length:542 Species:Danio rerio

Alignment Length:551 Identity:124/552 (22%)
Similarity:173/552 (31%) Gaps:189/552 (34%)


  Fly     9 CRTCMDETGTLVDIFANVRDPVLDEPEM--------SLSHILARCTERPVKRG-----DLLPQFI 60
            |....:||       .:|:|...||.::        |||     |||...||.     ...|.|.
Zfish    43 CTPVKEET-------QDVKDEEEDEEQLIDPESTQTSLS-----CTETHNKRFKRRRLQTKPGFK 95

  Fly    61 CVSC----------------------VLAVQNAFRFKWQSEQSYQHF--------FRVLNQSGAP 95
            |..|                      ....|...||. |....|.|.        || ..|.|..
Zfish    96 CSQCGKSFSREGHLESHMRIHTGETPFTCKQCGKRFN-QKGNLYSHMKIHSGESPFR-CQQCGKS 158

  Fly    96 ENQ-----VHLAACNGD--------------KNQIINQKMQLKSDRQQDTQQMTKTQKPDDDLSQ 141
            .||     :|:....|:              |..::|.......:|....::..|:      .:|
Zfish   159 FNQKGNLKLHMRIHTGECPFTCKHCDKSFSLKGNLMNHMKTHSGERSFACRRCGKS------FTQ 217

  Fly   142 KQTLQA--KLQEGNIDGPPESF---------------TLHPRKRTCRTEEQADMIPKEATRSTKM 189
            .:||::  |:.||:..|.....               |.|..|:|....|......:..|..   
Zfish   218 NKTLKSHMKVHEGDQCGVCSRHRSSCSDAKCSNRHLRTKHEEKQTVECSEMGISDDQRLTSD--- 279

  Fly   190 ICDADGYYNCPHCS-----KRFCSQTQLRTHITDLCNRCPYCPRTYMQKSNLKRHLRNHLSKPAH 249
              |.:..:.|..|.     |||. |..||.|..:....|.:|..||..:.|.|.|:|.|..:...
Zfish   280 --DREKPFQCQQCPRSFRLKRFL-QLHLRIHTGEKPFVCRHCGETYTHQGNFKVHVRMHTEERPF 341

  Fly   250 KCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVFIEHVQLEIHRREHKQRPGSS---KSEST 311
            .|.||.|.|..:.:|:.|:|.|..:.|..|..|...|:....|:.|...|.:| |.|   |.|..
Zfish   342 ICPHCGKHFHHQGNLRSHMRLHTREKPYPCPLCGESFVYSTHLKTHLEFHSER-GKSHMLKREYV 405

  Fly   312 KDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPMLKPKPICDICQKKFSSVYALKRHMLTH--NRQH 374
            .:|.|...|.                         :.|||.|.:.|.|.|.|:.|.:..  :|.|
Zfish   406 NEPSSQSEDS-------------------------RFICDCCGRNFLSRYHLEVHQICRGDDRPH 445

  Fly   375 HLKKCTYCSEEFKTEKHLKRHERGH---------------------------------------- 399
               .|.:||..||...:||.|.|.|                                        
Zfish   446 ---VCCFCSMSFKWIGNLKAHMRWHGSVKAAAGVIRRPLIHSDAKTDEESGKLKRGTCETSTEAE 507

  Fly   400 ----MGD-LFRCEFCSLVFVDVNYLRKHKKR 425
                .|: |:.|..|.:.|....||..|||:
Zfish   508 RREKNGEKLYYCSTCGMSFSTCIYLLAHKKK 538

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 25/111 (23%)
COG5048 220..>284 CDD:227381 21/64 (33%)
C2H2 Zn finger 223..243 CDD:275368 8/20 (40%)
zf-C2H2 249..271 CDD:278523 8/22 (36%)
C2H2 Zn finger 251..271 CDD:275368 8/20 (40%)
C2H2 Zn finger 279..299 CDD:275368 5/20 (25%)
C2H2 Zn finger 350..370 CDD:275368 8/20 (40%)
C2H2 Zn finger 379..399 CDD:275368 9/20 (45%)
C2H2 Zn finger 406..427 CDD:275368 8/21 (38%)
si:ch211-241e1.5NP_001119897.1 COG5048 68..467 CDD:227381 106/447 (24%)
C2H2 Zn finger 96..116 CDD:275368 2/20 (10%)
zf-H2C2_2 108..133 CDD:290200 3/26 (12%)
C2H2 Zn finger 124..144 CDD:275368 6/21 (29%)
zf-H2C2_2 136..161 CDD:290200 7/26 (27%)
C2H2 Zn finger 152..172 CDD:275368 5/20 (25%)
zf-H2C2_2 164..188 CDD:290200 2/24 (8%)
C2H2 Zn finger 180..200 CDD:275368 2/20 (10%)
C2H2 Zn finger 208..228 CDD:275368 5/26 (19%)
C2H2 Zn finger 287..307 CDD:275368 8/21 (38%)
C2H2 Zn finger 315..335 CDD:275368 8/20 (40%)
C2H2 Zn finger 343..363 CDD:275368 8/20 (40%)
zf-H2C2_2 355..380 CDD:290200 8/25 (32%)
C2H2 Zn finger 371..391 CDD:275368 5/20 (25%)
C2H2 Zn finger 419..436 CDD:275368 8/17 (47%)
C2H2 Zn finger 447..467 CDD:275368 9/20 (45%)
C2H2 Zn finger 519..539 CDD:275368 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.