DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2678 and C27A12.2

Sequence 1:NP_649750.1 Gene:CG2678 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_491745.2 Gene:C27A12.2 WormBaseID:WBGene00016154 Length:603 Species:Caenorhabditis elegans

Alignment Length:465 Identity:88/466 (19%)
Similarity:140/466 (30%) Gaps:176/466 (38%)


  Fly    13 MDETGTLVDIFANVRDPVLDEPEMSLSHILARCTERPVKRGDLLPQFICVSCVLAVQNAF---RF 74
            |:|.......|..|.:|.:......:......|..:..:..:::...........|||..   .|
 Worm   159 MEENNATTSQFIQVAEPTIQAEPCQIYECSEMCGFQSYEEAEVVEHMTVTHYQQTVQNGLILQDF 223

  Fly    75 KWQSEQSYQHFFR--------------VLNQSGAPENQV---HLAACNGDKN---QIINQKMQLK 119
            ..:.|..|:.:..              .:.|...|...:   |:.|..|...   |::     .:
 Worm   224 NGEPEPIYEFYEEQYVQQVPTEIEETPTIKQQSIPYENLHFEHVEAAPGPSEPHLQVV-----AE 283

  Fly   120 SDRQQDTQQMTKTQKPDDDLSQKQTLQAKLQEG--NIDGPPESFTLHPRKRTCRTEEQADMI--- 179
            .:...|.:::.       |:|..::|:.::|.|  ||.|..:..           ||:.:.|   
 Worm   284 GEILYDGEEIV-------DISNGKSLKEEIQNGDANIYGMIQDL-----------EEEVEDIGNE 330

  Fly   180 ---------------PKEATRSTK-----------MICDA-------------DGYYNCPHCSKR 205
                           ||..|:|.:           ||.||             .||   |..|||
 Worm   331 DEERERVRIMVNPNPPKRGTKSLRDHHEATAATMEMIVDASILELAEPSRHLKQGY---PPISKR 392

  Fly   206 FCSQTQLRTHITD-----------------------LCNRCPYCPRTYMQKSNLKRHLRNHLSKP 247
              ..|..|....|                       ..::|.||.|.....|.::.|:|.|..:.
 Worm   393 --KNTGKRAENLDWIIDAVAKGVDVSEASPHHRKKPTLHKCEYCGRVDKYPSKIRAHMRTHTGEK 455

  Fly   248 AHKCFHCSKAFMRKDHLKRHLRTHDSDGPLSC--SQCSAVFIEHVQLEIH-RREHKQRPGSSKSE 309
            ..||..|..||.:|..::.|||.|....|..|  ..|...|:....|::| .::|          
 Worm   456 PFKCEICGMAFSQKTPMRLHLRRHFDQKPYECDVDGCKERFVSGAILKMHVEKKH---------- 510

  Fly   310 STKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPMLKPKPICDI-CQKKFSSVYALKRHMLTHNRQ 373
                                             :.|.|.:|.. |.:.|||.|         |::
 Worm   511 ---------------------------------LNKKKYVCSRGCGRVFSSAY---------NQK 533

  Fly   374 HHLKKC--TY 381
            ||.|||  ||
 Worm   534 HHEKKCEQTY 543

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 12/75 (16%)
COG5048 220..>284 CDD:227381 21/66 (32%)
C2H2 Zn finger 223..243 CDD:275368 7/20 (35%)
zf-C2H2 249..271 CDD:278523 9/22 (41%)
C2H2 Zn finger 251..271 CDD:275368 8/20 (40%)
C2H2 Zn finger 279..299 CDD:275368 5/23 (22%)
C2H2 Zn finger 350..370 CDD:275368 6/21 (29%)
C2H2 Zn finger 379..399 CDD:275368 3/6 (50%)
C2H2 Zn finger 406..427 CDD:275368
C27A12.2NP_491745.2 C2H2 Zn finger 73..93 CDD:275368
C2H2 Zn finger 101..121 CDD:275368
C2H2 Zn finger 129..149 CDD:275368
COG5048 <422..535 CDD:227381 35/165 (21%)
C2H2 Zn finger 431..451 CDD:275368 7/20 (35%)
zf-H2C2_2 445..468 CDD:290200 8/23 (35%)
C2H2 Zn finger 459..479 CDD:275368 8/20 (40%)
C2H2 Zn finger 487..506 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.