DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2678 and LOC110437726

Sequence 1:NP_649750.1 Gene:CG2678 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_021331500.1 Gene:LOC110437726 ID: Length:550 Species:Danio rerio

Alignment Length:368 Identity:96/369 (26%)
Similarity:150/369 (41%) Gaps:71/369 (19%)


  Fly   122 RQQDTQQMTKT---QKPDDDLSQ--KQTLQAKLQEGNIDGPPESFTLHPRKRTCRTEEQADMIPK 181
            :.:|.:|:|..   :...|:|:|  ::....|.||....|..|       |:|.:|:..|..|..
Zfish    20 KHEDAEQITDVLVLKVESDELNQMKEKDQYEKHQEIRTVGKSE-------KKTQKTKSHALFICC 77

  Fly   182 EATRS---------TKMICDADGYYNCPHCSKRF-----CSQTQLRTHITDLCNRCPYCPRTYMQ 232
            |..:|         .:.|...:..|.|.||.|.|     | :..:|.|..:...:|..|...:.|
Zfish    78 ECGKSFSHKPKLEVHRRIHTGEKPYECQHCGKSFNQKQNC-EAHMRIHTGEKPYKCQQCDMQFTQ 141

  Fly   233 KSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVFIE----HVQLE 293
            |:||..|:|.|..:....|.||.|:|.:|.:|..|:|.|..:.|..|.||...|.:    :|.|:
Zfish   142 KANLTVHMRVHTGEKTFNCQHCGKSFFQKQNLNVHMRVHTGEKPYQCQQCGKSFSQPQNLNVHLK 206

  Fly   294 IHRRE-------------HKQR--------PGS--------SKSESTKDPDSDDSDQAQDLKP-- 327
            :|..|             |||:        .|.        .||.|.|....|......::||  
Zfish   207 VHTGEKPFTCQECGKSFIHKQKFEAHMRIHTGEKLYKCLQCGKSFSQKTYLEDHMGIHAEVKPFS 271

  Fly   328 -KWTKNTFNGTCSIPPMLK----PKPI-CDICQKKFSSVYALKRHMLTHNRQHHLKKCTYCSEEF 386
             :....:||....:...::    .||. |..|.:.||...:|:.||..|..:... .|..|.:.|
Zfish   272 CQQCGKSFNQKQKLKMHMRVHTGEKPYSCQHCGRSFSQAPSLEVHMRVHTGEKPY-TCDQCGKTF 335

  Fly   387 KTEKHLKRHERGHMGDL-FRCEFCSLVFVDVNYLRKHKKRIHS 428
            ..:.||.:|.|.|.|:. :.|:.|.:.|...:.|.:|.| ||:
Zfish   336 AQKGHLDKHTRVHTGEKPYTCDLCGISFAQKSNLNRHLK-IHT 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871
COG5048 220..>284 CDD:227381 23/64 (36%)
C2H2 Zn finger 223..243 CDD:275368 8/20 (40%)
zf-C2H2 249..271 CDD:278523 9/22 (41%)
C2H2 Zn finger 251..271 CDD:275368 9/20 (45%)
C2H2 Zn finger 279..299 CDD:275368 8/37 (22%)
C2H2 Zn finger 350..370 CDD:275368 7/20 (35%)
C2H2 Zn finger 379..399 CDD:275368 7/20 (35%)
C2H2 Zn finger 406..427 CDD:275368 7/21 (33%)
LOC110437726XP_021331500.1 COG5048 73..485 CDD:227381 81/309 (26%)
C2H2 Zn finger 76..96 CDD:275368 3/20 (15%)
C2H2 Zn finger 104..124 CDD:275368 7/21 (33%)
C2H2 Zn finger 132..152 CDD:275368 8/20 (40%)
C2H2 Zn finger 160..180 CDD:275368 9/20 (45%)
C2H2 Zn finger 188..208 CDD:275368 6/20 (30%)
C2H2 Zn finger 216..236 CDD:275368 3/20 (15%)
C2H2 Zn finger 244..264 CDD:275368 5/20 (25%)
C2H2 Zn finger 272..292 CDD:275368 2/20 (10%)
C2H2 Zn finger 300..320 CDD:275368 7/20 (35%)
C2H2 Zn finger 328..348 CDD:275368 7/20 (35%)
C2H2 Zn finger 356..376 CDD:275368 7/21 (33%)
C2H2 Zn finger 384..404 CDD:275368
C2H2 Zn finger 412..432 CDD:275368
C2H2 Zn finger 440..460 CDD:275368
C2H2 Zn finger 468..488 CDD:275368
C2H2 Zn finger 496..514 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.