DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2678 and LOC100537431

Sequence 1:NP_649750.1 Gene:CG2678 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_009301501.1 Gene:LOC100537431 ID: Length:434 Species:Danio rerio

Alignment Length:419 Identity:98/420 (23%)
Similarity:154/420 (37%) Gaps:80/420 (19%)


  Fly    66 LAVQNAFRFKWQSEQSYQHFFRVLNQSGAPENQVH--LAACNGDKNQIINQK-------MQLKSD 121
            |.::..|..| |.:...|....||.:....:|::.  |.....|:...:.:|       .:.||.
Zfish    11 LKIEETFTVK-QEDLQEQTDLMVLKEEAHEQNEMEEKLQEITTDEKPTLTKKTSSRGRPRKSKSA 74

  Fly   122 RQQDTQQMTKTQKPDDDLSQKQTLQAKLQE------------GNIDGPPESFTLHPRKRTCRTEE 174
            ....::|..|:      .|||..|....:|            |:|.|......:|..::....::
Zfish    75 CNFGSKQSRKS------FSQKSNLDVHTREKPYTCEQCGKSFGHIQGFENHMRIHTGEKPFSCKQ 133

  Fly   175 QADMIPKEATRSTKM-ICDADGYYNCPHCSKRFCSQ----TQLRTHITDLCNRCPYCPRTYMQKS 234
            ......::|.....| :...:..|.|..|.|.|..:    |.:|.|..:....|..|.:::....
Zfish   134 CGKSFTQKANLDVHMRVHTKERPYTCEQCGKSFTYKQGFTTHMRIHTGERPYTCQQCEKSFYHPG 198

  Fly   235 NLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVFIEHVQLEIHRREH 299
            |...|:|.|..:..:.|..|.|:|.:..:...|:|.|..:.|.||.||...|.::..||:|.|.|
Zfish   199 NFAVHMRIHTGERPYTCQQCGKSFYQSGNFAAHMRIHTGERPYSCIQCGKSFKQNCTLEVHMRTH 263

  Fly   300 KQRPGSSKSESTKDPDSDDS----------DQAQDL----------KP--------KWT-KNTFN 335
                           ..|.|          .|..||          ||        ::| |.:.:
Zfish   264 ---------------TGDRSFMCTHCGKCFSQKHDLNIHMRIHTGKKPHTCTQCGKRFTQKTSLD 313

  Fly   336 GTCSIPPMLKPKPICDICQKKFSSVYALKRHMLTHNRQHHLKKCTYCSEEFKTEKHLKRHERGHM 400
            ...||....||.. |..|.|.|....:||.||.||..:... .||.|...|.|:..||....||.
Zfish   314 NHMSIHTGEKPYR-CTECGKTFPHKSSLKHHMRTHTGEKPF-ACTQCGTRFTTKASLKNLMDGHT 376

  Fly   401 GDL-FRCEFCSLVFVDVNYLRKHKKRIHS 428
            |.: ..|:.|.......:.:|||.::|:|
Zfish   377 GTIVLTCDQCEKSLTRKDSIRKHIRKINS 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 5/19 (26%)
COG5048 220..>284 CDD:227381 18/64 (28%)
C2H2 Zn finger 223..243 CDD:275368 5/20 (25%)
zf-C2H2 249..271 CDD:278523 6/22 (27%)
C2H2 Zn finger 251..271 CDD:275368 6/20 (30%)
C2H2 Zn finger 279..299 CDD:275368 8/20 (40%)
C2H2 Zn finger 350..370 CDD:275368 9/20 (45%)
C2H2 Zn finger 379..399 CDD:275368 8/20 (40%)
C2H2 Zn finger 406..427 CDD:275368 6/21 (29%)
LOC100537431XP_009301501.1 COG5048 73..433 CDD:227381 86/357 (24%)
C2H2 Zn finger 103..123 CDD:275368 3/20 (15%)
zf-H2C2_2 116..140 CDD:290200 1/24 (4%)
C2H2 Zn finger 131..151 CDD:275368 2/20 (10%)
zf-H2C2_2 143..168 CDD:290200 6/25 (24%)
C2H2 Zn finger 159..179 CDD:275368 6/20 (30%)
zf-H2C2_2 174..194 CDD:290200 5/20 (25%)
C2H2 Zn finger 187..207 CDD:275368 5/20 (25%)
zf-H2C2_2 199..222 CDD:290200 7/23 (30%)
C2H2 Zn finger 215..235 CDD:275368 6/20 (30%)
zf-H2C2_2 227..252 CDD:290200 9/25 (36%)
C2H2 Zn finger 243..263 CDD:275368 8/20 (40%)
zf-H2C2_2 256..280 CDD:290200 7/39 (18%)
C2H2 Zn finger 271..291 CDD:275368 3/20 (15%)
zf-H2C2_2 283..308 CDD:290200 5/25 (20%)
C2H2 Zn finger 299..319 CDD:275368 4/20 (20%)
zf-H2C2_2 311..334 CDD:290200 7/24 (29%)
zf-C2H2 325..347 CDD:278523 9/23 (39%)
C2H2 Zn finger 327..347 CDD:275368 9/20 (45%)
zf-H2C2_2 339..364 CDD:290200 10/26 (38%)
C2H2 Zn finger 383..404 CDD:275368 6/21 (29%)
C2H2 Zn finger 412..432 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.