DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2678 and LOC100536649

Sequence 1:NP_649750.1 Gene:CG2678 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_017209955.1 Gene:LOC100536649 ID: Length:448 Species:Danio rerio

Alignment Length:428 Identity:98/429 (23%)
Similarity:150/429 (35%) Gaps:94/429 (22%)


  Fly    68 VQNAFRFKWQSEQSYQHFFRVLNQSGAPENQVHLAACNGDKNQIINQKMQLKSD------RQQDT 126
            ::..|..| |.:...|....||.:....:|:.       |:.|...:..::.:|      ::..:
Zfish    13 IEETFTVK-QEDLQEQTDLMVLKEETHGQNET-------DEKQQFEKPQEIMTDEKPTLTKKTSS 69

  Fly   127 QQMTKTQKPDDDLSQKQTLQAKLQEGNID---------------------GPPESFTLH------ 164
            .:..:..|...:.|.||..::..|:.|:|                     |..:.|..|      
Zfish    70 HRRLRKSKSGCNFSCKQCRKSFSQKSNLDVHMRVHTREQPFTCEQCGKSFGQIQGFKAHMRIHSG 134

  Fly   165 PRKRTC-------RTEEQADMIPKEATRSTKMICDADGY--------------------YNCPHC 202
            .||.||       |.........:..|...|..|...|.                    ::|..|
Zfish   135 ERKFTCQECGKSFRHARNLAAHMRTHTGERKFTCQECGKSFYHAGHFAAHMRIHTGEKPFSCKQC 199

  Fly   203 SKRFCSQTQL----RTHITDLCNRCPYCPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDH 263
            .|.||.:..|    |.|..:....|..|.:::.|..|.|.|:|.|..:..:.|..|.|:|....:
Zfish   200 GKSFCQKPNLDVHMRVHTGEKPYTCEQCGKSFSQIQNFKIHMRIHTGERPYTCQQCGKSFYHAGN 264

  Fly   264 LKRHLRTHDSDGPLSCSQCSAVFIEHVQLEIHRREH-KQRPGSSKSESTKDPDSDDSDQAQDLKP 327
            |..|:|||..:.|.||.||...|.:...|..|.|.| :::|      .|.:.......:.|||..
Zfish   265 LAEHMRTHTGEKPFSCKQCRKSFSKKPHLIAHMRVHTREKP------YTCEQCEKSLGKNQDLYI 323

  Fly   328 KWTKNTFNGTCSIPPMLKPKP-ICDICQKKFSSVYALKRHMLTHNRQHHLKKCTYCSEEFKTEKH 391
            ....:|           ..|| .|..|.|.|.....|..||..|..:... .|..|.:.|.|:..
Zfish   324 HMRIHT-----------GEKPYTCTECGKSFPHKNTLNHHMRIHTGEKPF-ACAQCGKSFTTKTS 376

  Fly   392 LKRHERGHMGDL-FRCEFCSLVFVDVNYLRKHKKRIHS 428
            ||.|...|.|.: |.|:.|.......:.::||.| |||
Zfish   377 LKNHMNVHTGTIVFTCDQCGKSLTRKDTIKKHMK-IHS 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 4/17 (24%)
COG5048 220..>284 CDD:227381 22/64 (34%)
C2H2 Zn finger 223..243 CDD:275368 7/20 (35%)
zf-C2H2 249..271 CDD:278523 8/22 (36%)
C2H2 Zn finger 251..271 CDD:275368 8/20 (40%)
C2H2 Zn finger 279..299 CDD:275368 7/20 (35%)
C2H2 Zn finger 350..370 CDD:275368 7/20 (35%)
C2H2 Zn finger 379..399 CDD:275368 7/20 (35%)
C2H2 Zn finger 406..427 CDD:275368 6/21 (29%)
LOC100536649XP_017209955.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.