DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2678 and zgc:174314

Sequence 1:NP_649750.1 Gene:CG2678 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001107958.1 Gene:zgc:174314 ZFINID:ZDB-GENE-080213-5 Length:359 Species:Danio rerio

Alignment Length:351 Identity:79/352 (22%)
Similarity:127/352 (36%) Gaps:90/352 (26%)


  Fly   122 RQQDTQQMTKTQKPDDDLSQKQTLQAKLQEGNIDGPPE------------------SFTLHPRKR 168
            :|:|.|:.|......::..|...::.|.|:...|..|.                  :|:...|::
Zfish    20 KQEDLQEQTDLMVLKEETHQCNEMEEKHQDIMADEKPTLTKKTSSRGRPRKSKSKCNFSSKQRRK 84

  Fly   169 TCRTEEQADMIPKEATRSTKMICDADGY--------------------YNCPHCSKRFCSQTQLR 213
            |...:.:.|:..:..|......|...|.                    |.|..|.|.||.:...:
Zfish    85 TFSQKPKLDVHMRVHTGEKPCTCKQCGKSFYTIGNLTVHMRIHTGEKPYTCEQCGKSFCKKENFK 149

  Fly   214 THITDLCNRCPY----CPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSD 274
            ||:.......||    |.:::....||..|:|.|..:..:.|..|.|:|.:..:|:.|:|||..:
Zfish   150 THMRIHTGERPYTCQQCGKSFYHSGNLIMHMRIHTEERPYSCPQCGKSFKQNGNLEVHMRTHTGE 214

  Fly   275 GPLSCSQCSAVFIEHVQLEIHRREHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCS 339
            ...:|:||...|::...|:||.|.|...                                     
Zfish   215 KRFTCTQCGKSFVKKQNLDIHMRIHTGE------------------------------------- 242

  Fly   340 IPPMLKPKP-ICDICQKKFSSVYALKRHMLTHNRQHHLKKCTYCSEEFKTEKHLKRHERGHMGDL 403
                   || .|..|.|.|:...:|..||.||..::.. .|..|.:.|.|:..|..|..||.|.:
Zfish   243 -------KPYTCTECGKSFTYKSSLNHHMRTHTGENPF-ACAQCGKSFSTKSSLMNHMNGHTGTI 299

  Fly   404 -FRCEFCSLVFVDVNYLRKHKKRIHS 428
             |.|:.|.:.....:|:|:|.| .||
Zfish   300 VFTCDQCGIKLKRKDYIRRHMK-THS 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871
COG5048 220..>284 CDD:227381 20/68 (29%)
C2H2 Zn finger 223..243 CDD:275368 7/24 (29%)
zf-C2H2 249..271 CDD:278523 8/22 (36%)
C2H2 Zn finger 251..271 CDD:275368 8/20 (40%)
C2H2 Zn finger 279..299 CDD:275368 8/20 (40%)
C2H2 Zn finger 350..370 CDD:275368 8/20 (40%)
C2H2 Zn finger 379..399 CDD:275368 7/20 (35%)
C2H2 Zn finger 406..427 CDD:275368 6/21 (29%)
zgc:174314NP_001107958.1 COG5048 <71..263 CDD:227381 48/236 (20%)
zf-H2C2_2 92..116 CDD:290200 4/24 (17%)
C2H2 Zn finger 107..127 CDD:275368 2/20 (10%)
zf-H2C2_2 119..142 CDD:290200 4/23 (17%)
C2H2 Zn finger 135..155 CDD:275368 7/20 (35%)
zf-H2C2_2 147..170 CDD:290200 5/23 (22%)
C2H2 Zn finger 163..183 CDD:275368 5/20 (25%)
zf-H2C2_2 175..200 CDD:290200 9/25 (36%)
C2H2 Zn finger 191..211 CDD:275368 8/20 (40%)
zf-H2C2_2 203..227 CDD:290200 9/24 (38%)
COG5048 219..>359 CDD:227381 38/153 (25%)
C2H2 Zn finger 219..239 CDD:275368 8/20 (40%)
zf-H2C2_2 231..256 CDD:290200 11/69 (16%)
C2H2 Zn finger 247..267 CDD:275368 8/20 (40%)
zf-H2C2_2 259..284 CDD:290200 8/26 (31%)
C2H2 Zn finger 275..295 CDD:275368 7/20 (35%)
C2H2 Zn finger 331..351 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.