DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Taf7 and TAF7

Sequence 1:NP_649748.1 Gene:Taf7 FlyBaseID:FBgn0024909 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_013954.1 Gene:TAF7 SGDID:S000004840 Length:590 Species:Saccharomyces cerevisiae

Alignment Length:526 Identity:111/527 (21%)
Similarity:213/527 (40%) Gaps:135/527 (26%)


  Fly    28 KNRIEM---FEKKSDKVKQAEHKA----------------------RDDGVELESQFIMRV-PKE 66
            ||.:::   .:|..:.||:. |||                      .||.: :||..|:|: |..
Yeast    62 KNSLKLKLNLKKNEEPVKKI-HKAPKLRLKPIRIPGEAYDSEASDIEDDPL-IESGVILRILPDI 124

  Fly    67 LADTVHEAINAGTIKDRLTIQLDPDLRYGEVRIDDQILYTKLVDLPTVVESYKTIDNKSFYKSAD 131
            ..:.|..::.:|.... ::|:...: |:..|.|:|.:....|||||||:|..|::|.|:..|:.|
Yeast   125 QLEFVKNSLESGDYSG-ISIKWKNE-RHAVVTINDVMYGAILVDLPTVIEVNKSVDRKNLLKTFD 187

  Fly   132 ICQILIC---KEEREDETEKESPN-----------------KNKK---KDPNKVD---------- 163
            :.|:|:|   .:|.|:....|:|:                 :||:   |..|...          
Yeast   188 VSQMLLCIRPIQEEEEVYALEAPDTEDLVVKHFEGIEDEIWENKETFLKGYNGAPLSDMEAKHLK 252

  Fly   164 ----KKYLFPHGITPPCKNVRKRRFRKTLKKKNVEAPEIEKEVKHLLRIDNEAVRVDYEII---- 220
                |.|.:.|||:||..|||.||||:.:....::  .:||.|..||:.|.:|..|.|:::    
Yeast   253 EIALKGYDYKHGISPPLYNVRNRRFRRKMDPNEID--YVEKVVDMLLKQDKQAEEVSYDLVDKSE 315

  Fly   221 ------------NEEDKPMDELEQSDIKPYNDADDDLQDESTMHASEKTIMEMSSQRHLQVESDD 273
                        |.:::|.:.|.:..:|           :..:|.....:.:..::...:...::
Yeast   316 LQARQERVSSWENFKEEPGEPLSRPALK-----------KEEIHTIASAVGKQGAEEEGEEGMEE 369

  Fly   274 DEASNFPSHRAPNMGVAVHDIFGEEVSSTDDEDEPDRGNNTMQRRVMEESSRLSADDSRMSDFFG 338
            :|..:.      ::|.|    |..|...:..|.:.::....:...|.:::.....||....|...
Yeast   370 EEEEDL------DLGAA----FESEEEGSGAEGDKEQQQEEVGDEVDQDTGGEDDDDDDDGDIEA 424

  Fly   339 ASGSNTGAGVVKMEQNVFSKSMFGHEASSPKLSAAGSSSNLAAPSGFYDSQMLAKREEFENMEFI 403
            |.|.:....  :.::|.....:...|.:..:.:.|.:...|:..:    :.:|..|       ||
Yeast   425 AGGESESDD--EKDENRQHTELLADELNELETTLAHTKHKLSKAT----NPLLKSR-------FI 476

  Fly   404 DEPQPQYTQQQVQQKINQLTRQIRELKAQQVQKSTEIASIQNATLKQRMQETLDNLYTQVIEREL 468
            |             .|.:|.:: .|||.:|:|::.:  |:|.....:...||.:|:..:..|.|.
Yeast   477 D-------------SIKKLEKE-AELKRKQLQQTED--SVQKQHQHRSDAETANNVEEEEEEEEE 525

  Fly   469 ELKDFE 474
            |.::.|
Yeast   526 EEEEDE 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Taf7NP_649748.1 TAFII55_N 55..213 CDD:282507 57/196 (29%)
TAF7NP_013954.1 Taf7 1..498 CDD:227701 102/490 (21%)
TAFII55_N 112..304 CDD:282507 57/196 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141112588
eggNOG 1 0.900 E1_COG5414
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I1620
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001796
OrthoInspector 1 1.000 T1136391
orthoMCL 1 0.900 OOG5_128786
Panther 1 1.100 LDO PTHR12228
Phylome 1 0.910 0.944 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1474
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.