DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf7 and TAF7

DIOPT Version :9

Sequence 1:NP_649748.1 Gene:Taf7 / 40934 FlyBaseID:FBgn0024909 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001031194.1 Gene:TAF7 / 841975 AraportID:AT1G55300 Length:239 Species:Arabidopsis thaliana


Alignment Length:170 Identity:50/170 - (29%)
Similarity:84/170 - (49%) Gaps:37/170 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LESQFIMRVPKELADTVHEAINA-GTIKDRLTIQL--DPDLRYGEVRIDDQILYTKLVDLPTVVE 116
            :|.|||:|||..:::.:...::. .:..|.:.:.|  ..|.|.|...|.:......|:|||.|||
plant     1 MEEQFILRVPPSVSERIDRLLSEDASTSDEIPLDLFFSEDGRNGTFMIGNDEFPASLLDLPAVVE 65

  Fly   117 SYKTIDNKSFYKSADICQILICKEEREDETEKESPNKNKKKDPNKVDKKYLFPHGITPPCKNVRK 181
            |:||.|:.:..|:|||.|:::.:|..:..             ||.|:    :.||:|||.|:.||
plant    66 SFKTYDDCALVKTADIGQMIMVREPGDPA-------------PNTVE----YRHGLTPPMKDARK 113

  Fly   182 RRFRKTLKKKNVEAPEIEKEVKHLLRIDNEAVRVDYEIIN 221
            ||||:        .|::..|:         ..||:.:::|
plant   114 RRFRR--------EPDLNPEL---------VQRVERDLLN 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf7NP_649748.1 TAFII55_N 55..213 CDD:282507 47/160 (29%)
TAF7NP_001031194.1 TAF7 2..144 CDD:173966 50/169 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3291
eggNOG 1 0.900 - - E1_COG5414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1348389at2759
OrthoFinder 1 1.000 - - FOG0001971
OrthoInspector 1 1.000 - - oto3941
orthoMCL 1 0.900 - - OOG6_102177
Panther 1 1.100 - - LDO PTHR12228
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1289
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.