DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Taf7 and TAF7

Sequence 1:NP_649748.1 Gene:Taf7 FlyBaseID:FBgn0024909 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001031194.1 Gene:TAF7 AraportID:AT1G55300 Length:239 Species:Arabidopsis thaliana

Alignment Length:170 Identity:50/171 (29%)
Similarity:84/171 (49%) Gaps:37/171 (22%)


  Fly    55 LESQFIMRVPKELADTVHEAINA-GTIKDRLTIQL--DPDLRYGEVRIDDQILYTKLVDLPTVVE 116
            :|.|||:|||..:::.:...::. .:..|.:.:.|  ..|.|.|...|.:......|:|||.|||
plant     1 MEEQFILRVPPSVSERIDRLLSEDASTSDEIPLDLFFSEDGRNGTFMIGNDEFPASLLDLPAVVE 65

  Fly   117 SYKTIDNKSFYKSADICQILICKEEREDETEKESPNKNKKKDPNKVDKKYLFPHGITPPCKNVRK 181
            |:||.|:.:..|:|||.|:::.:|..:..             ||.|:    :.||:|||.|:.||
plant    66 SFKTYDDCALVKTADIGQMIMVREPGDPA-------------PNTVE----YRHGLTPPMKDARK 113

  Fly   182 RRFRKTLKKKNVEAPEIEKEVKHLLRIDNEAVRVDYEIIN 221
            ||||:        .|::..|:         ..||:.:::|
plant   114 RRFRR--------EPDLNPEL---------VQRVERDLLN 136

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Taf7NP_649748.1 TAFII55_N 55..213 CDD:282507 47/161 (29%)
TAF7NP_001031194.1 TAF7 2..144 CDD:173966 50/170 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1348389at2759
OrthoInspector 1 1.000 T192844
orthoMCL 1 0.900 OOG5_128786
Panther 1 1.100 LDO PTHR12228
Phylome 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.