DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Taf7 and Taf7l

Sequence 1:NP_649748.1 Gene:Taf7 FlyBaseID:FBgn0024909 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_083234.2 Gene:Taf7l MGIID:1921719 Length:471 Species:Mus musculus

Alignment Length:454 Identity:125/455 (27%)
Similarity:193/455 (42%) Gaps:145/455 (32%)


  Fly    54 ELESQFIMRVPKELADTVHEAINA--GTIKDRLTIQLDPDLRYGEVRIDDQILYTKLVDLPTVVE 116
            ::|.|||:|:|.|.|..|.:.|::  ...||:|.|...||..:..|::|:..|..|||:||.|:.
Mouse   105 DVEEQFILRLPPEQAYAVRKIIHSRNAAWKDKLKIDFSPDGHHAVVQVDNVSLPAKLVNLPCVIG 169

  Fly   117 SYKTIDNKSFYKSADICQILICKEEREDETEKESP-----------NKNKKKDPNKVDKKYLFPH 170
            |.||||.|:|||:||:.|:|:|..|.|..:..|.|           ::.|.:     .|||.:.|
Mouse   170 SLKTIDRKTFYKTADVSQMLVCSPEGEPHSPPEEPVVSTGPTVIGISEGKAE-----RKKYNWKH 229

  Fly   171 GITPPCKNVRKRRFRKTLKK----KNV---------EAPEIEKEVKHLLRIDNEAVRVDYEIINE 222
            |||||.|||||:|||||.||    |.|         ::|.:|||||.||..|.|||.|.:|::::
Mouse   230 GITPPLKNVRKKRFRKTTKKLPDVKQVDEINFSEYTQSPSVEKEVKRLLYSDAEAVSVRWEVVDD 294

  Fly   223 EDKPMDELEQSDIKPYN--------------DADDDLQDESTMHASEKTIMEMSSQRHLQVESDD 273
            :|  ..|:|.....|..              |...::..:|..::::  :.|.|:      |.||
Mouse   295 DD--AKEIESQGSMPTTPGISQMGGASLSDYDVFREMMGDSGSNSND--VEEKSN------EGDD 349

  Fly   274 DEASNFPSHRAPNMGVAVHDIFGEEVSSTDDEDEPDRGNNTMQRRVMEESSRLSADDSRMSDFFG 338
            |:                          .:|||:.|.||...:.........|..:         
Mouse   350 DD--------------------------DEDEDDEDYGNEKEEEETDNSEEELEKE--------- 379

  Fly   339 ASGSNTGAGVVKMEQNVFSKSMFGHEASSPKLSAAGSSSNLAAPSGFYDSQMLAKREEFENMEFI 403
                      ::.:.|.||.    |||...                 |.|..:|    .:.:.||
Mouse   380 ----------LQAKFNEFSL----HEADQD-----------------YSSITMA----IQKLIFI 409

  Fly   404 DEPQPQYTQQQVQQKINQLTRQIRELKAQQVQKSTEIASIQNATLKQRMQETLDNLYTQVIERE 467
            .|.:.|...::.|::        :||          :..::|.|||:..|..|..|  .::|:|
Mouse   410 KEKRLQMIYKKAQRQ--------KEL----------LRKVENLTLKRHFQNVLGKL--NIMEKE 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Taf7NP_649748.1 TAFII55_N 55..213 CDD:282507 78/184 (42%)
Taf7lNP_083234.2 TAFII55_N 106..285 CDD:282507 78/184 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113151759
eggNOG 1 0.900 E1_COG5414
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3977
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1348389at2759
OrthoFinder 1 1.000 FOG0001796
OrthoInspector 1 1.000 T616607
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12228
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.860

Return to query results.
Submit another query.