DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Taf7 and TAF7

Sequence 1:NP_649748.1 Gene:Taf7 FlyBaseID:FBgn0024909 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_005633.2 Gene:TAF7 HGNCID:11541 Length:349 Species:Homo sapiens

Alignment Length:443 Identity:145/444 (33%)
Similarity:210/444 (47%) Gaps:110/444 (25%)


  Fly    47 KARDDGV-ELESQFIMRVPKELADTVHEAINAG--TIKDRLTIQLDPDLRYGEVRIDDQILYTKL 108
            |::||.. |||||||:|:|.|.|.||..|:.:|  .:||||||:|.||.|:|.||:|...|.:||
Human     3 KSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKL 67

  Fly   109 VDLPTVVESYKTIDNKSFYKSADICQILICKEER------EDETEKESPNKNKKKDPNKVDKKYL 167
            ||||.|:||.||||.|:|||:|||||:|:...:.      |:......|..:||||.:| :||::
Human    68 VDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDK-EKKFI 131

  Fly   168 FPHGITPPCKNVRKRRFRKTLKKKNVEAPEIEKEVKHLLRIDNEAVRVDYEIINEEDKPMDELEQ 232
            :.||||.|.|||||||||||.|||.:|:|::|||||.||..|.|||...:|||.|::....|.:.
Human   132 WNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQG 196

  Fly   233 SDIKPYNDADDDLQDESTMHASEKTIMEMSSQRHLQVESDDDEASNFPSHRAPNMGVAVHDIFGE 297
            .||....                   |....|.|..:|.|:                 :.:||.:
Human   197 LDISSPG-------------------MSGHRQGHDSLEHDE-----------------LREIFND 225

  Fly   298 EVSSTDDEDEPDRGNNTMQRRVMEESSRLSADDSRMSDFFGASGSNTGAGVVKMEQNVFSKSMFG 362
            ..||::||||....:        ||.                      ..::..|:::       
Human   226 LSSSSEDEDETQHQD--------EED----------------------INIIDTEEDL------- 253

  Fly   363 HEASSPKLSAAGSSSNLAAPSGFYDSQMLAKREEFENMEFIDEPQPQYTQQQVQQKINQLTRQIR 427
                                    :.|:..|..|.:.....:|...|.. ..:|::|:.:..:::
Human   254 ------------------------ERQLQDKLNESDEQHQENEGTNQLV-MGIQKQIDNMKGKLQ 293

  Fly   428 ELKAQQVQKSTEIASIQNATLKQRMQETLDNLYTQVIERELE-LKDFENMLES 479
            |.:.:..::...|..::|..||.|.|..||.| .|..:||.| |...:..|||
Human   294 ETQDRAKRQEDLIMKVENLALKNRFQAVLDEL-KQKEDREKEQLSSLQEELES 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Taf7NP_649748.1 TAFII55_N 55..213 CDD:282507 92/166 (55%)
TAF7NP_005633.2 [KR]-[STA]-K motif 3..5 1/2 (50%)
TAFII55_N 12..177 CDD:309687 92/166 (55%)
MDN1 <185..305 CDD:331582 28/218 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113153623
eggNOG 1 0.900 E1_COG5414
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3483
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1348389at2759
OrthoFinder 1 1.000 FOG0001796
OrthoInspector 1 1.000 T609798
orthoMCL 1 0.900 OOG5_128786
Panther 1 1.100 LDO PTHR12228
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1474
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.