DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Taf7 and Taf7l2

Sequence 1:NP_649748.1 Gene:Taf7 FlyBaseID:FBgn0024909 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001155327.1 Gene:Taf7l2 MGIID:6274337 Length:378 Species:Mus musculus

Alignment Length:465 Identity:133/466 (29%)
Similarity:206/466 (44%) Gaps:130/466 (28%)


  Fly    47 KARDDGV-ELESQFIMRVPKELADTVHEAINAG--TIKDRLTIQLDPDLRYGEVRIDDQILYTKL 108
            |:||:.. |||:|||:|:|.|.|..|.:.|.:|  .::::|.|.|.||.|...|::|...|..||
Mouse     3 KSRDEPPHELENQFILRLPPEQASAVRKIIRSGNAAMREKLKIDLSPDSRRAVVQVDGVSLSAKL 67

  Fly   109 VDLPTVVESYKTIDNKSFYKSADICQILICK-EEREDETEKESPNK--------NKKKDPNKVDK 164
            ||||.|:.|.||.|.|:|||:||:.|:|:|. ::.:..|..|.|..        |||    :.:.
Mouse    68 VDLPCVIGSLKTHDGKTFYKTADVSQMLLCSADDGDPHTSPEEPATSAGATVVGNKK----EAEG 128

  Fly   165 KYLFPHGITPPCKNVRKRRFRKTLKK------------KNVEAPEIEKEVKHLLRIDNEAVRVDY 217
            ||::.||||||.|||||:||||..||            ..:::.::|||||.|||.|.||:...:
Mouse   129 KYIWKHGITPPLKNVRKKRFRKPTKKPADMKQGEESCRAYIDSKDVEKEVKRLLRSDAEAISSRW 193

  Fly   218 E-IINEEDKPMDELEQSDIKPYNDADDDLQDESTMHAS------EKTIMEMSSQRHLQVESDDDE 275
            | ::::|.|.:.....:...|       |..|:..|.|      :.|..:.||.:......|::|
Mouse   194 EVVVDDETKAVPSQTCTSHVP-------LPPEAGDHTSSACAMPQSTFSDSSSGKDDPENKDEEE 251

  Fly   276 ASNFPSHRAPNMGVAVHDIFGEEVSSTDDEDEPDRGNNTMQRRVMEESSRLSADDSRMSDFFGAS 340
            ...                  :|....:||||.|.          ||......|||...      
Mouse   252 EEE------------------KEEKEEEDEDEEDE----------EEEEEEEEDDSEED------ 282

  Fly   341 GSNTGAGVVKMEQNVFSKSMFGHEASSPKLSAAGSSSNLAAPSGFYDSQMLAKREEFENMEFIDE 405
                      :|:.:.:|.:   |.|   |..|..||:         |.:|.             
Mouse   283 ----------LERELQAKFI---EFS---LCEANESSS---------SVILG------------- 309

  Fly   406 PQPQYTQQQVQQKINQLTRQIRELKAQQVQKSTEIASIQNATLKQRMQETLDNL-------YTQV 463
                     :|:.|:...|:::|::|:..::...:..::|.|||...|..||.|       |.|:
Mouse   310 ---------IQKLIHSKERKLQEIQAKAQRQKDLLRKLENLTLKSHFQSVLDQLKLQEKQKYEQI 365

  Fly   464 IERELELKDF 473
            :..:.:||.|
Mouse   366 LFLQEQLKCF 375

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Taf7NP_649748.1 TAFII55_N 55..213 CDD:282507 77/181 (43%)
Taf7l2NP_001155327.1 TAFII55_N 12..188 CDD:282507 76/180 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113151752
eggNOG 1 0.900 E1_COG5414
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3977
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001796
OrthoInspector 1 1.000 T616607
orthoMCL 1 0.900 OOG5_128786
Panther 1 1.100 O PTHR12228
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1474
TreeFam 1 0.960
1110.780

Return to query results.
Submit another query.