DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Taf7 and TAF7L

Sequence 1:NP_649748.1 Gene:Taf7 FlyBaseID:FBgn0024909 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_006724727.1 Gene:TAF7L HGNCID:11548 Length:463 Species:Homo sapiens

Alignment Length:505 Identity:127/506 (25%)
Similarity:203/506 (40%) Gaps:183/506 (36%)


  Fly    32 EMFEKKSDKVKQAEHKARDDGVELESQFIMRVPKELADTVHEAINAGTI--KDRLTIQLDPDLRY 94
            |.|::..| :.:::.:..|   |:|:|||:|:|.|.|.||.....:.::  ||:|.|.|.||.|:
Human    79 ENFQEGKD-MSESQDEVPD---EVENQFILRLPLEHACTVRNLARSQSVKMKDKLKIDLLPDGRH 139

  Fly    95 GEVRIDDQILYTKLVDLPTVVESYKTIDNKSFYKSADICQILICKEEREDETEKESPNKNKKKDP 159
            ..|.::|..|..||||||.|:||.:|:|.|:|||:|||.|:|:|..:.:.....|.|..:  .||
Human   140 AVVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQMLVCTADGDIHLSPEEPAAS--TDP 202

  Fly   160 NKV-------DKKYLFPHGITPPCKNVRKRRFRKTLKK-------------KNVEAPEIEKEVKH 204
            |.|       ::|.::.||||||.|||||:|||||.||             :.:|:|::|.|||.
Human   203 NIVRKKERGREEKCVWKHGITPPLKNVRKKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKR 267

  Fly   205 LLRIDNEAVRVDYEIINEEDKPMDELEQ---------------------------------SDIK 236
            |||.|.|||...:|:|.|:.  ..|:|.                                 ||.:
Human   268 LLRSDAEAVSTRWEVIAEDG--TKEIESQGSIPGFLISSGMSSHKQGHTSSVEYDMLREMFSDSR 330

  Fly   237 PYNDADDDLQDESTMHASEKTIMEMSSQRHLQVESDDDEASNFPSHRAPNMGVAVHDIFGEEVSS 301
            ..||.|:|..||                     :.|:||                    .|:...
Human   331 SNNDDDEDEDDE---------------------DEDEDE--------------------DEDEDE 354

  Fly   302 TDDEDEPDRGNNTMQRRVMEESSRLSADDSRMSDFFGASG---SNTGAGVVKMEQNVFSKSMFGH 363
            ..:|:|.|.....::|::..|              |..||   :|.|...:.||           
Human   355 DKEEEEEDCSEEYLERQLQAE--------------FIESGQYRANEGTSSIVME----------- 394

  Fly   364 EASSPKLSAAGSSSNLAAPSGFYDSQMLAKREEFENMEFIDEPQPQYTQQQVQQKINQLTRQIRE 428
                                                               :|::|.:..:::.:
Human   395 ---------------------------------------------------IQKQIEKKEKKLHK 408

  Fly   429 LKAQQVQKSTEIASIQNATLKQRMQETLDNLYTQVIERELELKDFENMLE 478
            ::.:..::...|..::|.|||...|..|:.|..|..::..:|...:..|:
Human   409 IQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQKNEKLISLQEQLQ 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Taf7NP_649748.1 TAFII55_N 55..213 CDD:282507 79/180 (44%)
TAF7LXP_006724727.1 TAFII55_N 98..276 CDD:282507 79/180 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113151773
eggNOG 1 0.900 E1_COG5414
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3483
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1348389at2759
OrthoFinder 1 1.000 FOG0001796
OrthoInspector 1 1.000 T609798
orthoMCL 1 0.900 OOG5_128786
Panther 1 1.100 O PTHR12228
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.760

Return to query results.
Submit another query.