DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Taf7 and taf7

Sequence 1:NP_649748.1 Gene:Taf7 FlyBaseID:FBgn0024909 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001006764.1 Gene:taf7 XenbaseID:XB-GENE-5844280 Length:349 Species:Xenopus tropicalis

Alignment Length:448 Identity:136/449 (30%)
Similarity:201/449 (45%) Gaps:117/449 (26%)


  Fly    42 KQAEHKARDDGV-ELESQFIMRVPKELADTVHEAINAGTI--KDRLTIQLDPDLRYGEVRIDDQI 103
            ||...:::||.. |||||||:|:|:|.|.||...:.:|::  ||||:::|.||.|:|.||:|...
 Frog     5 KQKTSRSKDDAPHELESQFILRLPQEYASTVRRMVQSGSVNTKDRLSVELHPDGRHGIVRVDRVP 69

  Fly   104 LYTKLVDLPTVVESYKTIDNKSFYKSADICQILICKEE------REDETEKESPNKNKKKDPNKV 162
            |..||||:|.|||..||||.|:.||:|||||:|:|..:      .|:.|....|..:||||.:: 
 Frog    70 LAAKLVDIPCVVECLKTIDKKTCYKTADICQMLVCTLDGDLYPPLEEPTGTSDPKASKKKDRDR- 133

  Fly   163 DKKYLFPHGITPPCKNVRKRRFRKTLKKKNVEAPEIEKEVKHLLRIDNEAVRVDYEIINE-EDKP 226
            :||:::.||||||.|||||||||||.|||.:|:|::|||||.||..|.|||.|.:|:|.| |.|.
 Frog   134 EKKFIWNHGITPPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSVRWEVIAEDESKE 198

  Fly   227 MDELEQSDIKPYNDADDDLQDESTMHASEKTIMEMSSQRHLQVESDDDEASNFPSHRAPNMGVAV 291
            .:.|...|:.|........:..|.:...|                                   :
 Frog   199 AENLTGLDVSPGMSGIKQGRGSSAVEREE-----------------------------------L 228

  Fly   292 HDIFGEEVSSTDDEDEPDRGNNTMQRRVMEESSRLSADDSRMSDFFGASGSNTGAGVVKMEQNVF 356
            ..||.:..||:|.|:|...........:||......|         |..|...|...:.:|    
 Frog   229 RQIFNDISSSSDGEEEEGERQEEEDLNIMETEEEQRA---------GQDGQKGGTNQIVLE---- 280

  Fly   357 SKSMFGHEASSPKLSAAGSSSNLAAPSGFYDSQMLAKREEFENMEFIDEPQPQYTQQQVQQKINQ 421
                                                                      :|:::..
 Frog   281 ----------------------------------------------------------MQKQLEN 287

  Fly   422 LTRQIRELKAQQVQKSTEIASIQNATLKQRMQETLDNLYTQVIERELELKDFENMLES 479
            |.:::||.:.::.::...|..::|..||.|:|..||....|....:.:|...:..||:
 Frog   288 LQKKLRETQERRKRQEELIMKVENVALKTRLQAVLDEFRQQEEREKQQLTSLQEQLET 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Taf7NP_649748.1 TAFII55_N 55..213 CDD:282507 89/166 (54%)
taf7NP_001006764.1 TAFII55_N 19..184 CDD:309687 89/166 (54%)
Nup88 <274..346 CDD:313406 17/135 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113153592
eggNOG 1 0.900 E1_COG5414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1348389at2759
OrthoFinder 1 1.000 FOG0001796
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.