DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Taf7 and Taf7l

Sequence 1:NP_649748.1 Gene:Taf7 FlyBaseID:FBgn0024909 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001129349.1 Gene:Taf7l RGDID:1564898 Length:465 Species:Rattus norvegicus

Alignment Length:517 Identity:129/518 (25%)
Similarity:194/518 (37%) Gaps:206/518 (40%)


  Fly     1 MPSLAVPHLTPISNEHLVSSKEVVFFWKNRIEMFEKKSDKVKQAEHKARDDGVELESQFIMRVPK 65
            :||.|.||.|..|...                  .:...|..:|.....::..|:|.|||:|:| 
  Rat    87 VPSRAEPHGTRPSTAR------------------GRALQKAMRAMSLRHEESHEIEEQFILRLP- 132

  Fly    66 ELADTVHEAINAGTIKDRLTIQLDPDLRYGEVRIDDQILYTKLVDLPTVVESYKTIDNKSFYKSA 130
            .:.|. |.|:                     |::::..|..|||:||.|:.|.||:|.|:||::|
  Rat   133 PVTDG-HHAV---------------------VQVENVSLPAKLVNLPCVIGSLKTVDRKTFYQTA 175

  Fly   131 DICQILICKEEREDETEKESP-------------NKNKKKDPNKVDKKYLFPHGITPPCKNVRKR 182
            ||.|:|:|..|.|..:..|.|             .|.:|       |||.:.||||||.|||||:
  Rat   176 DISQMLVCSPEGEPHSSPEEPVISTGPTVTGHIEGKAEK-------KKYNWKHGITPPLKNVRKK 233

  Fly   183 RFRKTLKK-------------KNVEAPEIEKEVKHLLRIDNEAVRVDYEIINEEDKPMDELEQSD 234
            |||||.||             :..::|.:|||||.||..|.|||.|.:|::              
  Rat   234 RFRKTTKKLPDVKQMDEINFSEYTQSPSVEKEVKRLLCSDAEAVSVRWEVV-------------- 284

  Fly   235 IKPYNDADDDLQDESTMHASEKTIMEMSSQRHLQVESDDDEASNFPSHRAPNMGVA-------VH 292
                  ||||.:             |:.||..:...|.           .|.||.|       :.
  Rat   285 ------ADDDTK-------------EIESQGCISTTSG-----------TPQMGGAGSSEYDVLR 319

  Fly   293 DIFGEEVSSTDD-EDEPDRGNNTMQRRVMEESSRLSADDSRMSDFFGASGSNTGAGVVKMEQNVF 356
            ::.||..|:::| ||:..:         :|:......:|....|                     
  Rat   320 EMMGETGSNSNDVEDKNSK---------IEDEDEDDQEDEDEDD--------------------- 354

  Fly   357 SKSMFGHEASSPKLSAAGSSSNLAAPSGFYDSQMLAKREEFENM--EFIDEPQPQYTQQQVQQKI 419
                 |:|                           .|.||.:|.  |...|.|.::.|..:.:|.
  Rat   355 -----GNE---------------------------EKEEETDNSEEELEKELQAKFIQSSLHEKE 387

  Fly   420 NQLTR---------QIRELKAQQVQKSTE-----IASIQNATLKQRMQETLDNLYTQVIERE 467
            ...|.         .|:|.|.||:.|..:     :.:::|.|||:..|..|:.|  .::|:|
  Rat   388 QDYTSIIMEIQKLIHIKEQKLQQIYKKAQRQKDLLRNVENLTLKRHFQNVLEKL--NILEKE 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Taf7NP_649748.1 TAFII55_N 55..213 CDD:282507 68/184 (37%)
Taf7lNP_001129349.1 Taf7 118..447 CDD:227701 119/467 (25%)
TAFII55_N 123..277 CDD:282507 68/184 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113151789
eggNOG 1 0.900 E1_COG5414
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3831
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1348389at2759
OrthoFinder 1 1.000 FOG0001796
OrthoInspector 1 1.000 T618727
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12228
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
109.860

Return to query results.
Submit another query.