DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Taf7 and Taf7

Sequence 1:NP_649748.1 Gene:Taf7 FlyBaseID:FBgn0024909 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001100864.1 Gene:Taf7 RGDID:1309935 Length:341 Species:Rattus norvegicus

Alignment Length:443 Identity:140/444 (32%)
Similarity:204/444 (46%) Gaps:118/444 (27%)


  Fly    47 KARDDGV-ELESQFIMRVPKELADTVHEAINAG--TIKDRLTIQLDPDLRYGEVRIDDQILYTKL 108
            |::||.. |||||||:|:|.|.|.||..|:.:|  .:||||:|:|.||.|:|.||:|...|..||
  Rat     3 KSKDDAPHELESQFILRLPPEYAATVRRAVQSGHVNLKDRLSIELHPDGRHGIVRVDRVPLAAKL 67

  Fly   109 VDLPTVVESYKTIDNKSFYKSADICQILICKEER------EDETEKESPNKNKKKDPNKVDKKYL 167
            ||||.|.||.||||.|:|||:|||.|:|:...:.      |:......|..|||||.:| :||::
  Rat    68 VDLPCVTESLKTIDKKTFYKTADISQMLVATVDGDLYPPVEEPAATADPKANKKKDKDK-EKKFV 131

  Fly   168 FPHGITPPCKNVRKRRFRKTLKKKNVEAPEIEKEVKHLLRIDNEAVRVDYEIINEEDKPMDELEQ 232
            :.||||.|.|||||||||||.|||.:|:|::|||||.||..|.|||...:|||.|::....|.:.
  Rat   132 WNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQG 196

  Fly   233 SDIKPYNDADDDLQDESTMHASEKTIMEMSSQRHLQVESDDDEASNFPSHRAPNMGVAVHDIFGE 297
            .||....                   |....|.|..:|.|:                 :.:||.:
  Rat   197 LDISSPG-------------------MSGHRQGHDSLEHDE-----------------LREIFND 225

  Fly   298 EVSSTDDEDEPDRGNNTMQRRVMEESSRLSADDSRMSDFFGASGSNTGAGVVKMEQNVFSKSMFG 362
            ..||::||::                                      ..::..|:::       
  Rat   226 LSSSSEDEED--------------------------------------VNIIDTEEDL------- 245

  Fly   363 HEASSPKLSAAGSSSNLAAPSGFYDSQMLAKREEFENMEFIDEPQPQYTQQQVQQKINQLTRQIR 427
                                    :.|:..|..|.:.....:|...|.. ..:|::|:.:..:::
  Rat   246 ------------------------ERQLQDKLNESDEQHQENEGTNQLV-MGIQKQIDNMKGKLQ 285

  Fly   428 ELKAQQVQKSTEIASIQNATLKQRMQETLDNLYTQVIERELE-LKDFENMLES 479
            |.:.:..::...|..::|..||.|.|..||.| .|..:||.| |...:..|||
  Rat   286 ETQDRAKRQEDLIMKVENLALKNRFQAVLDEL-KQKEDREKEQLSSLQEELES 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Taf7NP_649748.1 TAFII55_N 55..213 CDD:282507 91/166 (55%)
Taf7NP_001100864.1 TAFII55_N 12..177 CDD:282507 94/173 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113153636
eggNOG 1 0.900 E1_COG5414
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3831
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1348389at2759
OrthoFinder 1 1.000 FOG0001796
OrthoInspector 1 1.000 T618727
orthoMCL 1 0.900 OOG5_128786
Panther 1 1.100 LDO PTHR12228
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1110.760

Return to query results.
Submit another query.