DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Taf7 and ptr6

Sequence 1:NP_649748.1 Gene:Taf7 FlyBaseID:FBgn0024909 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_593650.1 Gene:ptr6 PomBaseID:SPAC13F5.02c Length:393 Species:Schizosaccharomyces pombe

Alignment Length:432 Identity:105/433 (24%)
Similarity:169/433 (39%) Gaps:112/433 (26%)


  Fly    44 AEHKARDDGVELESQFIMRVPK-ELADTVHEAINAGTIKDRLTIQLD-PDLRYGEVRIDDQILYT 106
            :|...|::...:|.|.|:|:|. |..:.|.:||....:.....|.:. .|.|...|.::..:...
pombe    61 SEASDREEDTYIEEQIILRLPPGEDCEYVRKAIENREVGRGADIWVKFKDQRRAVVHVNGHLYAA 125

  Fly   107 KLVDLPTVVESYKTIDNKSFYKSADICQILICKEEREDETEKESPNKNKKKDPNKVDKKYLFPHG 171
            ||||||.::||.|:.|.|..:|:|||||:||..|..|.|        |...:.......|::|||
pombe   126 KLVDLPCIIESNKSFDKKVIFKAADICQMLIATERIEHE--------NSVLNTQLKQADYIYPHG 182

  Fly   172 ITPPCKNVRKRRFRKTLKKKNVEAPEIEKEVKHLLRIDNEAVRVDYEIINEEDKPMDELEQSDIK 236
            :|.|...||::||||.:..:.:||  :|.||..||.:|..|.....|:|::.             
pombe   183 LTTPMHWVRQKRFRKRVSNRTIEA--VENEVDRLLAMDERAESTSNELIDQA------------- 232

  Fly   237 PYNDADDDLQDESTMHASEKTIME-MSSQRHLQVESDDDEASNFPSHRAPNMGVAVHDIFGEEVS 300
                   .|..:|::..||.|..: |:..|...::.||.....              |:|     
pombe   233 -------QLARDSSIALSEDTSFDGMAGLRGTSIDRDDQSVQT--------------DMF----- 271

  Fly   301 STDDEDEPDRGNNTMQRRVMEESSRLSADDSRMSDFFGASGSNTGAGVVKMEQNVFSKSMFGHEA 365
              |..||.|......|                              |::::.|:.        ..
pombe   272 --DGMDEDDLAGQIEQ------------------------------GMLELSQDT--------RE 296

  Fly   366 SSPKLSAAGSSSNLAAPSGFYDSQMLAKREEFENMEFIDEPQPQYTQQQVQQKINQLTRQ-IREL 429
            |:.:..|||..|              |..||.|..|..:|......:.:..::.|:|.|: |.||
pombe   297 STAEPRAAGEES--------------ASEEEEEEEEEEEEENEADDETRENKRQNRLVREFISEL 347

  Fly   430 KAQQVQKSTEIASIQNATLKQRMQETLDNLYTQVIERELELK 471
            ::...::..:.....|..|:.|....::.:.|     |||||
pombe   348 ESSIQKRRKDADEATNPILRNRFLADVNRMVT-----ELELK 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Taf7NP_649748.1 TAFII55_N 55..213 CDD:282507 57/160 (36%)
ptr6NP_593650.1 Taf7 1..393 CDD:227701 105/433 (24%)
TAFII55_N 72..222 CDD:282507 57/160 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I1604
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001796
OrthoInspector 1 1.000 T1125306
orthoMCL 1 0.900 OOG5_128786
Panther 1 1.100 LDO PTHR12228
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1474
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.