DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Taf7 and Taf7

Sequence 1:NP_649748.1 Gene:Taf7 FlyBaseID:FBgn0024909 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_786964.1 Gene:Taf7 MGIID:1346348 Length:341 Species:Mus musculus

Alignment Length:453 Identity:139/454 (31%)
Similarity:201/454 (44%) Gaps:138/454 (30%)


  Fly    47 KARDDGV-ELESQFIMRVPKELADTVHEAINAG--TIKDRLTIQLDPDLRYGEVRIDDQILYTKL 108
            |.:||.. |||||||:|:|.|.|.||..|:.:|  .:||:|:|:|.||.|:|.||:|...|..||
Mouse     3 KNKDDAPHELESQFILRLPPEYAATVRRAVQSGHVNLKDKLSIELHPDGRHGIVRVDRVPLAAKL 67

  Fly   109 VDLPTVVESYKTIDNKSFYKSADICQILICKEER------EDETEKESPNKNKKKDPNKVDKKYL 167
            ||||.|.||.||||.|:|||:|||.|:|:...:.      |:......|..|||||.:| :||::
Mouse    68 VDLPCVTESLKTIDKKTFYKTADISQMLVATVDGDLYPPVEEAAATADPKANKKKDKDK-EKKFV 131

  Fly   168 FPHGITPPCKNVRKRRFRKTLKKKNVEAPEIEKEVKHLLRIDNEAVRVDYEIINEEDKPMDELEQ 232
            :.||||.|.|||||||||||.|||.:|:|::|||||.||..|.|||...:|||.|::....|.:.
Mouse   132 WNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKETENQG 196

  Fly   233 SDIKPYNDADDDLQDESTMHASEKTIMEMSSQRHLQVESDDDEASNFPSHRAPNMGVAVHDIFGE 297
            .||....                   |....|.|..:|.|:                 :.:||.:
Mouse   197 LDISSPG-------------------MSGHRQGHDSLEHDE-----------------LREIFND 225

  Fly   298 EVSSTDDEDEPDRGNNTMQRRVMEESSRLSADDSRMSDFFGASGSNTGAGVVKMEQNVFSKSMFG 362
            ..||::||:                                                        
Mouse   226 LSSSSEDEE-------------------------------------------------------- 234

  Fly   363 HEASSPKLSAAGSSSNLAAPSGFYDSQMLAKREEFEN--MEFIDEPQPQYTQQQ--------VQQ 417
                                    |..:|...|:.|.  .:.::|...|:.:.:        :|:
Mouse   235 ------------------------DVNILDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQK 275

  Fly   418 KINQLTRQIRELKAQQVQKSTEIASIQNATLKQRMQETLDNLYTQVIERELE-LKDFENMLES 479
            :|:.:..:::|.:.:..::...|..::|..||.|.|..||.| .|..:||.| |...:..|||
Mouse   276 QIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDEL-KQKEDREKEQLSSLQEELES 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Taf7NP_649748.1 TAFII55_N 55..213 CDD:282507 90/166 (54%)
Taf7NP_786964.1 [KR]-[STA]-K motif 3..5 1/2 (50%)
TAFII55_N 12..177 CDD:282507 93/173 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113153601
eggNOG 1 0.900 E1_COG5414
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3977
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001796
OrthoInspector 1 1.000 T616607
orthoMCL 1 0.900 OOG5_128786
Panther 1 1.100 LDO PTHR12228
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1474
TreeFam 1 0.960
1110.780

Return to query results.
Submit another query.