DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Taf7 and taf-7.1

Sequence 1:NP_649748.1 Gene:Taf7 FlyBaseID:FBgn0024909 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_509976.1 Gene:taf-7.1 WormBaseID:WBGene00006388 Length:254 Species:Caenorhabditis elegans

Alignment Length:239 Identity:87/240 (36%)
Similarity:130/240 (54%) Gaps:34/240 (14%)


  Fly    47 KARDDGVELESQFIMRVPKELADTVHEAINAGTIKDRLTIQLDPDLRYGEVRIDDQILYTKLVDL 111
            |..:|..|.|...|:|||.::.:.:.:|:|.....:.|.|....|.|..::|:.:|||..|::||
 Worm    15 KQHEDNEEWEEHLILRVPPDVVNRMEKAVNGEIDAEELGINFQEDNRTVQIRLGNQILPAKILDL 79

  Fly   112 PTVVESYKTIDNKSFYKSADICQILICK------------------EEREDETEKE-SPNKNKKK 157
            ||:.|.:||:||.:.||..|:.|::||:                  |.||.:.|.| |..:||..
 Worm    80 PTINEVHKTLDNSTLYKVTDVSQMIICEGAMPIPKAERKKLNPEGIENREPKIEVEGSGVENKTN 144

  Fly   158 DPNKVD--------KKYLFPHGITPPCKNVRKRRFRKTLKKKNVEAPEIEKEVKHLLRIDNEAVR 214
            ..:|..        |:|.:|||||||.||.:||||||..:||.:...|||.|:|.|||.|.||..
 Worm   145 VQSKTARQLAKEKVKEYHYPHGITPPMKNAKKRRFRKKKEKKTMAVEEIEIELKRLLRSDLEAQS 209

  Fly   215 VDYEII-NEEDKPMDELEQSDIKPY-NDADDDL-QDESTMHASE 255
            |.:::: ::|..|.||    ||:.| ||...|| :|:..:..|:
 Worm   210 VRWKVVDDDETNPEDE----DIEVYDNDDGSDLDKDDKDLFLSD 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Taf7NP_649748.1 TAFII55_N 55..213 CDD:282507 70/185 (38%)
taf-7.1NP_509976.1 TAFII55_N 23..208 CDD:282507 70/185 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113153733
eggNOG 1 0.900 E1_COG5414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1348389at2759
OrthoFinder 1 1.000 FOG0001796
OrthoInspector 1 1.000 T374667
orthoMCL 1 0.900 OOG5_128786
Panther 1 1.100 LDO PTHR12228
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1474
TreeFam 1 0.960
109.740

Return to query results.
Submit another query.