DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Taf7 and taf7

Sequence 1:NP_649748.1 Gene:Taf7 FlyBaseID:FBgn0024909 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_775367.1 Gene:taf7 ZFINID:ZDB-GENE-020419-18 Length:362 Species:Danio rerio

Alignment Length:449 Identity:145/450 (32%)
Similarity:222/450 (49%) Gaps:105/450 (23%)


  Fly    40 KVKQAEHKARDDGV-ELESQFIMRVPKELADTVHEAINAGT--IKDRLTIQLDPDLRYGEVRIDD 101
            ||.:...|:::|.. |||||||:|:|:|.|.||.....:.:  :||||||:|..|.|:|.||:|.
Zfish     6 KVGKVGTKSKEDAPHELESQFILRLPQEYASTVRRIAQSSSMNMKDRLTIELHADGRHGIVRVDR 70

  Fly   102 QILYTKLVDLPTVVESYKTIDNKSFYKSADICQILICKEERE-----DETEKESPNKNKKKDPNK 161
            ..|..||||||.::||.||:|.|:|||:|||||:|:|..:.:     :|....:.:|:||||.:|
Zfish    71 VPLACKLVDLPCILESLKTVDKKTFYKTADICQMLVCTLDGDLYPPLEEPTGTTDSKSKKKDKDK 135

  Fly   162 VDKKYLFPHGITPPCKNVRKRRFRKTLKKKNVEAPEIEKEVKHLLRIDNEAVRVDYEIINEEDKP 226
             |||:::.||||.|.||.||||||||.|||.:|:|::|||||.||..|.|||.|.:|:|.|::. 
Zfish   136 -DKKFVWNHGITLPLKNTRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSVRWEVIAEDES- 198

  Fly   227 MDELEQSDIKPYNDADDDLQDESTMHASEKTIMEMSSQRHLQVESDDDEASNFPSHRAPNMGVAV 291
                        .:.|:.| ..|.:.:|..|                   |....|.:......:
Zfish   199 ------------KEPDNSL-SLSNLESSPGT-------------------SGHKGHGSSVQHDEL 231

  Fly   292 HDIFGEEVSSTDDEDEPDRGNNTMQRRVMEESSRLSADDSRMSDFFGASGSNTGAGVVKMEQNVF 356
            .:||.:..||::|||              ||..|...:|..:.|        |...:|:......
Zfish   232 REIFNDISSSSEDED--------------EEGDRHDDEDLNIMD--------TEDDMVRQLHEKL 274

  Fly   357 SKSMFGHEASSPKLSAAGSSSNLAAPSGFYDSQMLAKREEFENMEFIDEPQPQYTQQQVQQKINQ 421
            ::|..|.:.:.                  .:||::        ||:             |.:||.
Zfish   275 NESDGGRDEND------------------RNSQIV--------MEY-------------QMQINN 300

  Fly   422 LTRQIRELKAQQVQKSTEIASIQNATLKQRMQETLDNLYTQVIERELE-LKDFENMLES 479
            |..:::|.:|::.|:...|..::|..|:.|.|..|:.:..|. |:|:| |...:..|:|
Zfish   301 LKAKLQETRARKKQQEKLIMEVENQALRDRFQGLLNGMIRQE-EQEMEQLASLQEQLDS 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Taf7NP_649748.1 TAFII55_N 55..213 CDD:282507 88/165 (53%)
taf7NP_775367.1 Taf7 15..349 CDD:227701 139/430 (32%)
TAFII55_N 22..186 CDD:282507 88/165 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113153371
eggNOG 1 0.900 E1_COG5414
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3919
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1348389at2759
OrthoFinder 1 1.000 FOG0001796
OrthoInspector 1 1.000 T1053452
orthoMCL 1 0.900 OOG5_128786
Panther 1 1.100 LDO PTHR12228
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1474
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.