DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpS9 and mrps9

Sequence 1:NP_524270.2 Gene:mRpS9 FlyBaseID:FBgn0037529 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001038861.1 Gene:mrps9 ZFINID:ZDB-GENE-060825-257 Length:385 Species:Danio rerio

Alignment Length:326 Identity:153/327 (47%)
Similarity:225/327 (69%) Gaps:2/327 (1%)


  Fly    71 EFMKTQHLEFQIGKRHLANMMGADAETFTQEDIDEAISYLFPSGLYDQKARPAMKSPEVVFPARK 135
            ||:..|..||:|||||||||||.|.|||||||:|.:|:|||||||:::.|||.||.||.:||.:|
Zfish    61 EFIDKQVEEFEIGKRHLANMMGEDPETFTQEDVDRSIAYLFPSGLFEKHARPVMKHPEQIFPKQK 125

  Fly   136 AAEFDETGRPFHSMFYTGKPNFFQLLHDIVEETNKLADLEERMLRRGNKPDENQKLEIAGFQLLP 200
            |.::|..|||||.:|||||.:::.|:||:.::...:...:::|..:|....:.:::.::|.:.|.
Zfish   126 AVQWDAEGRPFHFLFYTGKQSYYSLMHDVYDKMLVVEKHQDKMRNKGLFMADTKQISLSGSRWLL 190

  Fly   201 KDQLELLLVESIADIEYSNFTNSMDRLIASPYAYKSKAFIERYMKPLMDQSKQLEVPKPRIDEEG 265
            |:::|.:|||:|:|.:|..|....:||::.||....:.||.::.|||..||::.|:|:.:.|..|
Zfish   191 KEEMEEILVENISDQDYLRFIQLAERLLSMPYCSLEENFILKFRKPLEVQSREQEIPELQHDARG 255

  Fly   266 RQYITTYECLRKTARADVTVRLPGTGKISINGKD-ISYFEDENCREQLLFPLQFSELLGKVDVEA 329
            ..: :..:..||:|:|.||:...|:|.|:|||.: :.||.....||||:|||.|..|||:.|:|.
Zfish   256 VAF-SVADGRRKSAKARVTLIDSGSGNITINGTNYLHYFPVLQDREQLMFPLHFVGLLGRFDIEG 319

  Fly   330 NVEGGGPSGQAGAIRWGIAMSLRSFVDQEMIESMRLAGLLTRDYRRRERKKFGQEGARRKYTWKK 394
            :|||.|.|.||||:|..|:.:|.|||.:..:|.||.|||||.|.|.:||||.|||.||:|:||||
Zfish   320 SVEGSGRSSQAGAVRLAISRALLSFVSEGEVEKMRQAGLLTADPRIKERKKPGQEKARKKFTWKK 384

  Fly   395 R 395
            |
Zfish   385 R 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS9NP_524270.2 Ribosomal_S9 276..395 CDD:278792 66/120 (55%)
mrps9NP_001038861.1 Ribosomal_S9 263..385 CDD:278792 66/122 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C266744646
eggNOG 1 0.900 E1_COG0103
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H32565
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1430790at2759
OrthoFinder 1 1.000 FOG0004202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127478
Panther 1 1.100 LDO PTHR21569
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.