DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and MTM1

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_011773.3 Gene:MTM1 SGDID:S000003489 Length:366 Species:Saccharomyces cerevisiae

Alignment Length:371 Identity:113/372 (30%)
Similarity:181/372 (49%) Gaps:65/372 (17%)


  Fly    92 QQVISACTGAMITACFMTPLDVIKTRMQSQQS-PAHKC-------FFYSNGLMDHLFAS--GPN- 145
            ::::||..|:::|:..:||:||::.|:|.||. |...|       ...|:|.....|.:  |.| 
Yeast    14 ERMLSAGAGSVLTSLILTPMDVVRIRLQQQQMIPDCSCDGAAEVPNAVSSGSKMKTFTNVGGQNL 78

  Fly   146 -----------GSELASLRQRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAY 199
                       ..||.......:|:.:.:|..||:..||:.:||.|:..||:.|:|:.::||..|
Yeast    79 NNAKIFWESACFQELHCKNSSLKFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGY 143

  Fly   200 EQFKARYLQIYESHYNKSQEPRHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQA 264
            |..:                    ::.....:.|::.|:..|..||:.|.|.::|:|||:||:|:
Yeast   144 EYIR--------------------DVSPIASTYPTLNPLFCGAIARVFAATSIAPLELVKTKLQS 188

  Fly   265 ------QRQTY---AQMLQFVRSVVALQG-VWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGH 319
                  ..:|:   ..:|...|..:.:.| ...|::||..|:.||||||.|||..||..|:.|..
Yeast   189 IPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWL 253

  Fly   320 GSQ---------PSFSLSFLAGVMAGTVAAIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKS 375
            .|.         ..|..||.:|.::|.:|||.|.||||.||..||.    ::....|......::
Yeast   254 DSTRFASKDANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQIS----MMNNSDPKGGNRSRN 314

  Fly   376 TFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFEYSKSFF 421
            .|..|..|:||.|:..|:.|...|::|:.|:||||||::|.||..|
Yeast   315 MFKFLETIWRTEGLAALYTGLAARVIKIRPSCAIMISSYEISKKVF 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 38/137 (28%)
Mito_carr 230..321 CDD:278578 35/101 (35%)
Mito_carr 321..425 CDD:278578 40/111 (36%)
MTM1NP_011773.3 Mito_carr 14..149 CDD:278578 38/155 (25%)
Mito_carr 154..255 CDD:278578 35/101 (35%)
Mito_carr 264..364 CDD:278578 39/102 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130798219
eggNOG 1 0.900 E1_KOG0761
Hieranoid 1 1.000
Homologene 1 1.000 H6040
Inparanoid 1 1.050 157 1.000 Inparanoid score I1062
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001348
OrthoInspector 1 1.000 T634697
orthoMCL 1 0.900 OOG5_127938
Panther 1 1.100 LDO PTHR45760
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2199
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.