DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and AT2G46320

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_850451.1 Gene:AT2G46320 AraportID:AT2G46320 Length:361 Species:Arabidopsis thaliana

Alignment Length:382 Identity:120/383 (31%)
Similarity:172/383 (45%) Gaps:72/383 (19%)


  Fly    72 DSKSSHRKLLSDPRFQIRPLQQVISACTGAMITACFMTPLDVIKTRMQSQQ-------SPAHKCF 129
            |.||.     |.|...::..::.:||...|.|:|..:.||||:|||:|:|.       |....||
plant     8 DPKSK-----SIPNENLKFGERALSAGGAAFISAVIVNPLDVVKTRLQAQAAGVPYQGSCRLGCF 67

  Fly   130 FYSNGLMDHLFASGPNG----SELASLRQRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALP 190
            ..::.|:..|.::...|    :..||:....|:..:.|...||.|.||.:.||.|...:|..|:|
plant    68 DTNSTLVHDLRSNSAPGMCRITGSASVCSDNQYKGTLDVFYKIIRQEGFSRLWRGTNASLTLAIP 132

  Fly   191 STIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPI 255
            :..||...|:.|:    .|.| .:...:.|          ||...||:::|..||..|.....|:
plant   133 TVGIYMPCYDYFR----NIME-EFTTEKSP----------SLTVYVPLVAGTIARSLACISCYPV 182

  Fly   256 ELVRTKMQAQRQTYAQMLQFVRSVVALQGVWG------------------LWRGLRPTILRDVPF 302
            ||.||:|||.:.|...        |.|.|||.                  ||.||...:.|||||
plant   183 ELARTRMQAFKGTQRN--------VKLPGVWKTLVDVVNPVKGSNNGYRMLWTGLGAQLARDVPF 239

  Fly   303 SGIYWPIYESLKQNL--GHGSQPS----FSLSFLAGVMAGTVAAIVTTPFDVVKTHEQIEFGERV 361
            |.|.|.|.|..::::  ..|.:|.    ...:|.||.:||.|||..|.|.||.||..|||.....
plant   240 SAICWSILEPTRRSIQSAMGEEPRAGSIIGANFAAGFVAGAVAAAATCPLDVAKTRRQIEKNTDR 304

  Fly   362 IFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFEYSK 418
            ..|         .:|...|..|:|..|:||:|:|.|.|:.:..|:.||::|.:|..|
plant   305 AMT---------MTTRQTLAEIWRDGGMRGMFSGAGARVGRAGPSVAIVVSFYEVVK 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 39/132 (30%)
Mito_carr 230..321 CDD:278578 37/111 (33%)
Mito_carr 321..425 CDD:278578 36/103 (35%)
AT2G46320NP_850451.1 Mito_carr 17..148 CDD:278578 40/135 (30%)
PTZ00169 26..356 CDD:240302 115/360 (32%)
Mito_carr 158..255 CDD:278578 36/105 (34%)
Mito_carr <286..352 CDD:278578 26/75 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6040
Inparanoid 1 1.050 149 1.000 Inparanoid score I1669
OMA 1 1.010
OrthoDB 1 1.010 D1007936at2759
OrthoInspector 1 1.000 T32324
orthoMCL 1 0.900 OOG5_127938
Panther 1 1.100 O PTHR45760
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.