DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and slc25a39

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_012827167.1 Gene:slc25a39 XenbaseID:XB-GENE-969813 Length:412 Species:Xenopus tropicalis

Alignment Length:366 Identity:156/367 (43%)
Similarity:220/367 (60%) Gaps:46/367 (13%)


  Fly    88 IRPLQQVISACTGAMITACFMTPLDVIKTRMQSQQSPAHK-------------------CFFYSN 133
            |.||||::::.|||::|:.|:|||||:|.|:|:|:.|..|                   ||.|.|
 Frog    69 ITPLQQILASGTGALLTSLFVTPLDVVKIRLQAQRKPLSKVLSVKPLPWALPMRHPKWRCFLYCN 133

  Fly   134 GLMDHLFASGPNGSELASLRQRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVA 198
            |||||||......:.....|....|:.:.||.:||:|||||.:|||||.||||.|:|:|||||..
 Frog   134 GLMDHLFVCQHATACSTWYRAPTYFNGTLDAFVKITRHEGLTSLWSGLPPTLVMAVPATIIYFTC 198

  Fly   199 YEQFKARYLQIYESHYNKSQEPRHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQ 263
            |:|.  |....|...|:.|.                 :|:::|..||:.||||:||:||:|||||
 Frog   199 YDQL--RDFLCYGLGYHGSH-----------------IPLIAGALARLGAVTVISPLELIRTKMQ 244

  Fly   264 AQRQTYAQMLQFVRSVVALQGVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGH---GSQPSF 325
            :::.:|.::...:||.|:..|...||:|..||:|||||||.:||..||.:|:.:.:   ..:..|
 Frog   245 SRQLSYMELGVCLRSAVSQDGWLSLWKGWGPTVLRDVPFSALYWFNYELVKKKMSNTKAAVESPF 309

  Fly   326 SLSFLAGVMAGTVAAIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVR 390
            .:||.||.::|.|||::|.|||||||..|||.|...:   .|:|. .:.||:..:..|....|.|
 Frog   310 LVSFSAGAVSGAVAAVLTLPFDVVKTQRQIELGNLEL---GPSRK-QRSSTWGAMRRIRAESGTR 370

  Fly   391 GLFAGCGPRLLKVAPACAIMISTFEYSKSFFFHYN-VRHHN 430
            |||||..||::|||||||||||::|:.|:||...| ::..|
 Frog   371 GLFAGFLPRVIKVAPACAIMISSYEFGKNFFQQQNKIKQQN 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 62/138 (45%)
Mito_carr 230..321 CDD:278578 39/94 (41%)
Mito_carr 321..425 CDD:278578 50/104 (48%)
slc25a39XP_012827167.1 Mito_carr 69..206 CDD:278578 62/139 (45%)
Mito_carr 219..300 CDD:278578 38/81 (47%)
Mito_carr <326..401 CDD:278578 40/79 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1007936at2759
OrthoFinder 1 1.000 FOG0001348
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2199
TreeFam 1 0.960
76.820

Return to query results.
Submit another query.