DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and CG7943

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_651766.1 Gene:CG7943 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster

Alignment Length:239 Identity:56/240 (23%)
Similarity:93/240 (39%) Gaps:50/240 (21%)


  Fly   170 RHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDTK----- 229
            |||||..|:.|:.|.|.....|..|.|..::..: |||                 :.|.:     
  Fly    96 RHEGLGFLYRGMLPPLAQKTISLSIMFGVFDGTR-RYL-----------------VEDYRLNDYG 142

  Fly   230 -KSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQR--QTYAQMLQFVRSVVALQGVWGLWRG 291
             |.|.:||   :|     .|.:::.|.|.|:|.:...:  |.::......|.||:..|...|:||
  Fly   143 AKVLAAVV---AG-----SAESILLPFERVQTLLADSKFHQHFSNTQNAFRYVVSHHGYRELYRG 199

  Fly   292 LRPTILRDVPFSGIYWPIYESLKQNLGHGSQPSFSL--SFLAGVMAGTVAAIVTTPFDVVKTHEQ 354
            |.|...|:...:.:::.:.|.....|......|...  .|:||.:.|...:.:..|.:|:|...|
  Fly   200 LEPVFWRNGLSNALFFVLREEASVRLPKRKSVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSLQ 264

  Fly   355 IEFGERVIFTDSPARDFGKKSTFSRLTGIY--RTHGVRGLFAGC 396
            .|.|:|            .:.::.....||  |...:...:.||
  Fly   265 SEMGQR------------SEGSWQACKRIYVERDRRIGNFYRGC 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 14/37 (38%)
Mito_carr 230..321 CDD:278578 23/93 (25%)
Mito_carr 321..425 CDD:278578 17/81 (21%)
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 16/58 (28%)
Mito_carr 141..229 CDD:278578 23/96 (24%)
Mito_carr 235..322 CDD:278578 16/75 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1996509
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.