DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and CG1907

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:329 Identity:73/329 - (22%)
Similarity:117/329 - (35%) Gaps:79/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWDALMKISRHEGL 174
            |||::|||||                     .||....       :.::.||...:..|...||.
  Fly    37 PLDLVKTRMQ---------------------ISGAGSG-------KKEYRSSLHCIQTIVSKEGP 73

  Fly   175 AALWSGLGPTLVSALPSTIIYFVAYEQFKARYL-QIYESHYNKSQEPRHLEIRDTKKSLPSVVPM 238
            .||:.|:|..|:.....|......|     .|| .::...:.:|               |.:...
  Fly    74 LALYQGIGAALLRQATYTTGRLGMY-----TYLNDLFREKF
QRS---------------PGITDS 118

  Fly   239 MS-GVTARICAVTVVSPIELVRTKMQ-------AQRQTYAQMLQFVRSVVALQGVWGLWRGLRPT 295
            |: |..|..|...:.:|.|:...:|.       |:|:.|..:...:..:...:|:..||||..||
  Fly   119 MAMGTIAGACGAFIGTPAEVALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPT 183

  Fly   296 ILRDVPFSGIYWPIYESLKQNLGHG---SQPSFSLSFLAGVMAGTVAAIVTTPFDVVKTHEQIEF 357
            :.|.:..:......|...|....||   .:....|.|.|.:::|.:..|.:.|.|:.||..|   
  Fly   184 VGRAMVVNMTQLASYSQFKTYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQ--- 245

  Fly   358 GERVIFTDSPARDFGK---KSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFE---- 415
              .:...|      ||   :.|...|..:.|..||..|:.|..|...::.|...:.....|    
  Fly   246 --NMKMVD------GKPEYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302

  Fly   416 -YSK 418
             |:|
  Fly   303 GYNK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 22/96 (23%)
Mito_carr 230..321 CDD:278578 23/101 (23%)
Mito_carr 321..425 CDD:278578 25/106 (24%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 24/104 (23%)
Mito_carr 118..207 CDD:278578 20/88 (23%)
Mito_carr 219..307 CDD:278578 24/99 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.