DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and mfrn

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:354 Identity:86/354 - (24%)
Similarity:139/354 - (39%) Gaps:80/354 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 MTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWDALMKISRHE 172
            |.|||.:||||||...|.                  .|.:.:::||            ..|:| |
  Fly    32 MYPLDSVKTRMQSLSPPT------------------KNMNIVSTLR------------TMITR-E 65

  Fly   173 GLAALWSGLGPTLVSALPSTIIYFVAYEQFK---ARYLQIYESHYNKSQEPRHLEIRDTKKSLPS 234
            ||.....|....::.|.|:..:||.|||..|   |::..:...:|                    
  Fly    66 GLLRPIRGASAVVLGAGPAHSLYFAAYEMTKELTAKFTSVRNLNY-------------------- 110

  Fly   235 VVPMMSGVTARICAVTVVSPIELVRTKMQAQRQTYAQMLQFVRSVVALQGVWGLWRGLRPTILRD 299
               ::||..|.:....:.||.::::.:||.....|..::..||.:...:|....:|.....::.:
  Fly   111 ---VISGAVATLIHDAISSPTDVIKQRMQMYNSPYTSVVSCVRDIYKREGFKAFYRAYGTQLVMN 172

  Fly   300 VPFSGIYWPIYESL--KQNLGHGSQPSFSLSFLAGVMAGTVAAIVTTPFDVVKTHEQIEFGERVI 362
            :|:..|::..||..  |.||.....|...::  ||..||..||.||||.||:||         ::
  Fly   173 LPYQTIHFTTYEFFQNKMNLERKYNPPVHMA--AGAAAGACAAAVTTPLDVIKT---------LL 226

  Fly   363 FTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFEYSKSFF------ 421
            .|.......|......:   ||...|..|.|.|...|:|...||.||..||:|:.|.:.      
  Fly   227 NTQETGLTRGMIEASRK---IYHMAGPLGFFRGTTARVLYSMPATAICWSTYEFFKFYLCGLDAD 288

  Fly   422 -FHYNVRHHNEALLLDNPKDTTVEDDDIE 449
             :..::...:|....|.....|.:::.|:
  Fly   289 QYKSSITGSSEPRKADYVLPRTTDEEQID 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 29/101 (29%)
Mito_carr 230..321 CDD:278578 19/92 (21%)
Mito_carr 321..425 CDD:278578 33/110 (30%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 28/96 (29%)
PTZ00168 17..280 CDD:185494 81/315 (26%)
Mito_carr 107..190 CDD:278578 17/105 (16%)
Mito_carr <215..282 CDD:278578 26/78 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441216
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.