| Sequence 1: | NP_001287212.1 | Gene: | CG2616 / 40915 | FlyBaseID: | FBgn0037512 | Length: | 449 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_651415.1 | Gene: | CG4743 / 43101 | FlyBaseID: | FBgn0039357 | Length: | 297 | Species: | Drosophila melanogaster | 
| Alignment Length: | 352 | Identity: | 88/352 - (25%) | 
|---|---|---|---|
| Similarity: | 143/352 - (40%) | Gaps: | 95/352 - (26%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    81 LSDPRFQIRPLQQVISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPN 145 
  Fly   146 GSELASLRQRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYE---QFKARYL 207 
  Fly   208 QIYESHYNKSQEPRHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQRQTYAQM 272 
  Fly   273 LQFVRSVVALQGV-WGLWRGLRPTILRDVPFSGIYWPIYESLKQN----LGHGSQPSFSLSFLAG 332 
  Fly   333 VMAGTVAAIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCG 397 
  Fly   398 PRLLKVAPACAIMISTFEYSKSFFFHY 424 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG2616 | NP_001287212.1 | Mito_carr | 86..207 | CDD:278578 | 20/123 (16%) | 
| Mito_carr | 230..321 | CDD:278578 | 25/95 (26%) | ||
| Mito_carr | 321..425 | CDD:278578 | 39/104 (38%) | ||
| CG4743 | NP_651415.1 | Mito_carr | 23..99 | CDD:278578 | 19/119 (16%) | 
| PTZ00168 | 25..281 | CDD:185494 | 86/342 (25%) | ||
| Mito_carr | 199..291 | CDD:278578 | 39/106 (37%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45441468 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||