DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and CG4743

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:352 Identity:88/352 - (25%)
Similarity:143/352 - (40%) Gaps:95/352 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LSDPRFQIRPLQQVISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPN 145
            :.:|..:::....:::.....|:....:.|:|.:|||:||:..      |:..|           
  Fly    18 MQEPVNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQSELG------FWRAG----------- 65

  Fly   146 GSELASLRQRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYE---QFKARYL 207
                                       |...::.||.|....:.|:..::|..||   ||.:...
  Fly    66 ---------------------------GFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVT 103

  Fly   208 QIYESHYNKSQEPRHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQRQTYAQM 272
            |..:|.|                     |.|.:...|.:.|..:..|:|:.:.:.|..:......
  Fly   104 QTKDSPY---------------------VHMAAASAAEVLACLIRVPVEIAKQRSQTLQGNKQSG 147

  Fly   273 LQFVRSVVALQGV-WGLWRGLRPTILRDVPFSGIYWPIYESLKQN----LGHGSQPSFSLSFLAG 332
            ||.:......:|: .||:||...||:|::|||.|.:|::|..|..    .|..|.| ||:: |.|
  Fly   148 LQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWTPLTGFDSTP-FSVA-LCG 210

  Fly   333 VMAGTVAAIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCG 397
            .:||.::|.:|||.|||||  :|...||    :|..|   ::|....|.|||...|..|||||..
  Fly   211 AVAGGISAGLTTPLDVVKT--RIMLAER----ESLNR---RRSARRILHGIYLERGFSGLFAGFV 266

  Fly   398 PRLLKVAPACAIMISTFEYSKSFFFHY 424
            ||:|.:.           ...:|||.:
  Fly   267 PRVLWIT-----------LGGAFFFGF 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 20/123 (16%)
Mito_carr 230..321 CDD:278578 25/95 (26%)
Mito_carr 321..425 CDD:278578 39/104 (38%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 19/119 (16%)
PTZ00168 25..281 CDD:185494 86/342 (25%)
Mito_carr 199..291 CDD:278578 39/106 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441468
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.