DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and CG5805

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster

Alignment Length:416 Identity:80/417 (19%)
Similarity:137/417 (33%) Gaps:127/417 (30%)


  Fly    43 SGGSGGTSGGNNLKPERSAREDDAINRLTDSKSSHRKLLSDPRFQIRPLQQVISACTGAMITACF 107
            :|..|...|...::    ..|.|.:|:   :|.....:||.  |.:|                |.
  Fly    17 TGVGGAAEGATYIR----TIEWDMMNK---TKFFPLSMLSS--FSVR----------------CC 56

  Fly   108 MTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWDALMKISRHE 172
            :.||.||||::|.|    ||...| .|::                          |..|||.|.|
  Fly    57 LFPLTVIKTQLQVQ----HKSDVY-KGMV--------------------------DCAMKIYRSE 90

  Fly   173 GLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDTKKSLPSVVP 237
            |:..|:.|...:.|. :.|.:.|...||..:.....:...|..|:                    
  Fly    91 GVPGLYRGFWISSVQ-IVSGVFYISTYEGVRHVLNDLGAGHRMKA-------------------- 134

  Fly   238 MMSGVTARICAVTVVSPIELVR----------------------TKMQAQRQTYAQMLQFVRSVV 280
            :..|..|.:...|::.|.:::.                      .|....|......:...|.::
  Fly   135 LAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINPLGIKSWPGRSRLHISMDIGREIM 199

  Fly   281 ALQGVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNL--------GHGSQPSFSLSFLAGVMAGT 337
            ...|..|.:||...:::..||.|.::|..|...:..|        .|     ..:..:||.:.|.
  Fly   200 RRDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQDELFRICPVWVSH-----LFIQCVAGSLGGF 259

  Fly   338 VAAIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLK 402
            ...|:|.|.|:|:...|:   .|:   ||.:..|.:         :::...:...|.|...||::
  Fly   260 TTTILTNPLDIVRARLQV---HRL---DSMSVAFRE---------LWQEEKLNCFFKGLSARLVQ 309

  Fly   403 VAPACAIMISTFEYSKSFFFHYNVRH 428
            .|.....:|..:|..|........:|
  Fly   310 SAAFSFSIILGYETIKRIAVDEQYKH 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 29/121 (24%)
Mito_carr 230..321 CDD:278578 18/121 (15%)
Mito_carr 321..425 CDD:278578 21/104 (20%)
CG5805NP_001287513.1 Mito_carr <55..125 CDD:278578 27/102 (26%)
Mito_carr 132..238 CDD:278578 18/126 (14%)
Mito_carr 245..327 CDD:278578 22/102 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1998170
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.