DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and Dic2

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_732512.1 Gene:Dic2 FlyBaseID:FBgn0038797 Length:304 Species:Drosophila melanogaster

Alignment Length:378 Identity:68/379 (18%)
Similarity:125/379 (33%) Gaps:121/379 (32%)


  Fly    95 ISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFS 159
            :::...||:|    .|:|:||..:|:|   |.|.                               
  Fly    24 LASSMAAMVT----HPIDLIKVLIQTQ---AEKL------------------------------- 50

  Fly   160 SSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLE 224
            |.:....||.:.:|..|:::|:..:::.....|:..|..|                         
  Fly    51 SVFQTTRKIVKEQGPLAMYNGISASMLRQYTYTLARFGIY------------------------- 90

  Fly   225 IRDTKKSLPSVVPMMSGVTARICAVTVV--------SPIELVRTKMQ-------AQRQTYAQMLQ 274
                  |:.|.....|.:..:.|...:.        :|.:|:..::|       .:|:.|...:.
  Fly    91 ------SVGSGAMDTSTMAGKTCLAAIAGGIGGFVGAPADLINVRLQNDVKLPPEKRRNYKHAID 149

  Fly   275 FVRSVVALQGVWGLWRGLRPTILRDVPFSGIYWPI-----YESLKQNLGHGSQPSFSLSF-LAGV 333
            .:..:...:|...|:.|.....||     |.:..:     ||..|..:.....|.:..:: ||.:
  Fly   150 GLVRITREEGWKNLFNGSSMIALR-----GAFMTVGQIAFYEQSKSQMIKLGMPDYMGTYILASM 209

  Fly   334 MAGTVAAIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGP 398
            ::..||..:|.|.|||||..         ...:|....|....|.:.:    ..|....|.|..|
  Fly   210 ISSVVATTLTQPIDVVKTRR---------MNAAPGEYSGLGDVFVKTS----KEGPLAFFKGYVP 261

  Fly   399 RLLKVAPACAIMISTFEYSKSFFFHYNVRHHNEALLLDNPKDTTV--EDDDIE 449
            .|.::.|...::....||.::.|.:           |..||.|..  ..||::
  Fly   262 SLSRLLPHTVLLFLGLEYLRTHFGY-----------LPEPKQTGAFYRYDDVD 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 20/112 (18%)
Mito_carr 230..321 CDD:278578 18/111 (16%)
Mito_carr 321..425 CDD:278578 24/105 (23%)
Dic2NP_732512.1 Mito_carr 22..90 CDD:278578 19/104 (18%)
Mito_carr 98..194 CDD:278578 16/101 (16%)
Mito_carr 198..285 CDD:278578 24/100 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1999646
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.