DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and GC2

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster

Alignment Length:372 Identity:90/373 (24%)
Similarity:159/373 (43%) Gaps:95/373 (25%)


  Fly    72 DSKSSHRKLLSDPRFQIRPLQQVISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLM 136
            :.|:..:|  ...:|.:.|  ::|:.....:|....:.|||::|||:|:|               
  Fly     6 EQKNQEQK--KPQKFNVFP--KIINGGVAGIIGVACVYPLDMVKTRLQNQ--------------- 51

  Fly   137 DHLFASGPNGSELASLRQRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQ 201
                ..||||..:        ::|..|...|....||...::.|....:|...|...|...|.:.
  Fly    52 ----TIGPNGERM--------YTSIADCFRKTIASEGYFGMYRGSAVNIVLITPEKAIKLTANDF 104

  Fly   202 FKARYLQIYESHYNKSQEPRHLEIRDTKKSLPSVVPM----MSGVTARICAVTVVSPIELVRTKM 262
            |  ||               ||...|      .|:|:    ::|..|.:..:.|.:|:||::.:|
  Fly   105 F--RY---------------HLASDD------GVIPLSRATLAGGLAGLFQIVVTTPMELLKIQM 146

  Fly   263 Q-AQRQTYAQML--QFVRSVVAL---------QGVWGLWRGLRPTILRDVPFSGIYWPIY----- 310
            | |.|...|...  :.|:::.||         :|::||::|:..|.:||:.||.:|:|:.     
  Fly   147 QDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVYFPLMAWIND 211

  Fly   311 ESLKQNLGHGSQPSFSLSFLAGVMAGTVAAIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKS 375
            :..:::.|.| :..|..|.:||:::|..:|.:.||||||||..|.: ||:..           |.
  Fly   212 QGPRKSDGSG-EAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQAD-GEKKF-----------KG 263

  Fly   376 TFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFEYSKSFFF 422
            ....:....:..|:...|.|...|::.:||       .|..::.|:|
  Fly   264 IMDCVNRTLKEEGISAFFKGGLCRIMVLAP-------LFGIAQMFYF 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 29/121 (24%)
Mito_carr 230..321 CDD:278578 29/112 (26%)
Mito_carr 321..425 CDD:278578 27/103 (26%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 83/340 (24%)
Mito_carr 16..106 CDD:278578 27/121 (22%)
Mito_carr 123..203 CDD:278578 24/80 (30%)
Mito_carr 228..302 CDD:278578 25/93 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2002263
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.