DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and GC1

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster

Alignment Length:341 Identity:96/342 (28%)
Similarity:149/342 (44%) Gaps:74/342 (22%)


  Fly    87 QIRPLQQVISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELAS 151
            |...|.::|:.....:|....:.|||::|||:|:||                   .||||..:  
  Fly    18 QFALLPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQ-------------------IGPNGERM-- 61

  Fly   152 LRQRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNK 216
                  ::|.:|...|..:.||...::.|.|..::...|...|...|.:.|              
  Fly    62 ------YNSMFDCFRKTYKAEGYFGMYRGSGVNILLITPEKAIKLTANDYF-------------- 106

  Fly   217 SQEPRH-LEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQ-AQRQTYAQML------ 273
                || |..:|.|  ||....|::|..|....:.|.:|:||::.:|| |.|...|..|      
  Fly   107 ----RHKLTTKDGK--LPLTSQMVAGGLAGAFQIIVTTPMELLKIQMQDAGRVAAAAKLAGKTVE 165

  Fly   274 -----QFVRSVVALQGVWGLWRGLRPTILRDVPFSGIYWPIYESL-----KQNLGHGSQPSFSLS 328
                 |....::..:|::||::|:..|.||||.||.||:|::.:|     ::|.|.| :..|..|
  Fly   166 KVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFATLNDLGPRRNDGSG-EAVFWCS 229

  Fly   329 FLAGVMAGTVAAIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLF 393
            ||||:.||:.||:...|||||||..|      .|......::|  |.....:|...:..|....|
  Fly   230 FLAGLAAGSTAALAVNPFDVVKTRLQ------AIKKADGEKEF--KGISDCITKTLKHEGPTAFF 286

  Fly   394 AGCGPRLLKVAPACAI 409
            .|...|::.:||...|
  Fly   287 KGGLCRMIVIAPLFGI 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 28/120 (23%)
Mito_carr 230..321 CDD:278578 34/108 (31%)
Mito_carr 321..425 CDD:278578 29/90 (32%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 27/122 (22%)
Mito_carr 115..213 CDD:278578 32/100 (32%)
Mito_carr 226..307 CDD:278578 29/86 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2002342
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.