DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and CG16736

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_649873.1 Gene:CG16736 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster

Alignment Length:318 Identity:61/319 (19%)
Similarity:118/319 (37%) Gaps:79/319 (25%)


  Fly   110 PLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWDALMKISRHEGL 174
            |:::::..||:      ....:|...::|:|                       .||  :|| ||
  Fly    19 PMELVRVNMQA------NVIHHSRLSINHMF-----------------------RLM--ARH-GL 51

  Fly   175 AALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDTKKSL---PSVV 236
            ...:.|:   :.:.|..|:.....|..|           ||         ::|.|..|   |...
  Fly    52 PGFYYGI---VAACLRCTVHTMSTYTLF-----------YN---------LQD
NKYVLMLQPYNT 93

  Fly   237 PMMSGVTARICAV--TVVSPIELVR----TKMQAQRQTYAQMLQFVRSVVALQGVWGLWRGLRPT 295
            .|:.|:|.....|  |..:.:.::|    |:...:|:.|....:.::.:.|..|...|:.|.:..
  Fly    94 SMVLGITGFWGGVLATPFAKLAVIRQADLTRGSYERRNYRNFWRGLKCMYAKGGFTYLFTGWKIN 158

  Fly   296 ILRDVPFSGIYWPIYESLKQNLG--HGSQPSFSLSFLAGVMAGTVAAIVTTPFDVVKTHEQIEFG 358
            .:.....:.:|.||.:.:...:.  |.....:....:...:.|::..::.||.|.:.|       
  Fly   159 SISSTAVAVLYTPISDKVHTVISWFHRLDEPWLSDLITMALTGSIITVIMTPVDALAT------- 216

  Fly   359 ERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFEY 416
                .|.:.:..:|:.|.......|.|.||.:|.|.|..|.|:.:.|  ..:::||.|
  Fly   217 ----LTLNESSHYGRTSYPYLYRKIIRKHGYKGFFFGWKPALMALIP--HTVLATFVY 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 17/97 (18%)
Mito_carr 230..321 CDD:278578 19/102 (19%)
Mito_carr 321..425 CDD:278578 21/97 (22%)
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 19/117 (16%)
Mito_carr 187..277 CDD:278578 21/96 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1999445
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.