DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and Dic4

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:237 Identity:52/237 - (21%)
Similarity:93/237 - (39%) Gaps:62/237 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LQQVISACTGAMITACFMTPLDVIKTRMQS-QQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQ 154
            |.::|..|......:.|..|.|:|..|||: .:.|.:|                           
  Fly   109 LGKIILGCVAGACGSAFGIPTDLINVRMQTDMKEPPYK--------------------------- 146

  Fly   155 RPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQE 219
            |..:...:|.|::|.:.||..||:.|....:..:..||......|:..             |::.
  Fly   147 RRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDII-------------KTEV 198

  Fly   220 PRHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQR--------QTYAQMLQFV 276
            .:::.:.|   .||  :..::.:...|.:..:..|:::|||.|...|        |....|::| 
  Fly   199 RKNISVND---GLP--LHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRF- 257

  Fly   277 RSVVALQGVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLG 318
                   ||.|.:||..|||:|..|.:.:.:.:||.|:.:.|
  Fly   258 -------GVMGPYRGFVPTIVRKAPATTLLFVLYEQLRLHFG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 24/116 (21%)
Mito_carr 230..321 CDD:278578 26/97 (27%)
Mito_carr 321..425 CDD:278578
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 50/231 (22%)
Mito_carr 26..100 CDD:278578
Mito_carr 104..201 CDD:278578 25/131 (19%)
Mito_carr 211..292 CDD:278578 23/88 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441457
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.