DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and CG6893

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_649053.2 Gene:CG6893 FlyBaseID:FBgn0036807 Length:250 Species:Drosophila melanogaster

Alignment Length:235 Identity:57/236 (24%)
Similarity:99/236 (42%) Gaps:59/236 (25%)


  Fly    91 LQQVISACTGAMITACFMTPLDVIKTRMQSQQS-PAHKCFFYSNGLMDHLFASGPNGSELASLRQ 154
            |.:|:.|.....:.....||:::|.||||..:: |....:.|.|                     
  Fly    62 LDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPKETRWNYRN--------------------- 105

  Fly   155 RPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQE 219
                  .:|.|.:::|.||...|:||...:.:.:...||....||:|.|    |||...:     
  Fly   106 ------VFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAK----QIYAEFF----- 155

  Fly   220 PRHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQRQTYAQMLQFVRSVVALQ- 283
              |::..:|      ::.::|.|||......::.|||.:|         |.:|:...|.:.::. 
  Fly   156 --HMKHDNT------LLHLISSVTAAFVCGPIIKPIENLR---------YLRMVDSRRLINSISY 203

  Fly   284 ----GVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGH 319
                |..|.:||:.|.:||.||.:.|.:..:|.|:.|.|:
  Fly   204 MMRFGSRGPFRGMVPYVLRMVPNTVITFLSFEQLRVNFGY 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 27/117 (23%)
Mito_carr 230..321 CDD:278578 25/96 (26%)
Mito_carr 321..425 CDD:278578
CG6893NP_649053.2 Mito_carr <5..55 CDD:278578
Mito_carr 57..151 CDD:278578 29/120 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1999707
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.