DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and Mpcp2

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001246757.1 Gene:Mpcp2 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster

Alignment Length:319 Identity:68/320 (21%)
Similarity:120/320 (38%) Gaps:82/320 (26%)


  Fly   104 TACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWDALMKI 168
            |..|:.|||::|.|:|..|:.      |.|  :.|.|                          |:
  Fly    76 THTFVVPLDLVKCRLQVDQAK------YKN--LVHGF--------------------------KV 106

  Fly   169 S-RHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDTKKSL 232
            : ..||...|..|..|||:......:..|..||.||.:|.:|.      .:|..:|    .:.||
  Fly   107 TVAEEGARGLAKGWFPTLLGYSAQGLCKFGLYELFK
VKYAEII------GEENAYL----YRTSL 161

  Fly   233 PSVVPMMSGVTARICAVTVVSPIELVRTKMQAQRQTYAQMLQFVRSVVALQGVWGLWRGLRPTIL 297
                .:.:..:|...|...::|.|..:.|:|..........:.|..::..:||...::||.|..:
  Fly   162 ----YLAASASAEFFADIALAPFEAAKVKIQTIPGYANNFREAVPKMLKEEGVNAFYKGLVPLWM 222

  Fly   298 RDVPFSGIYWPIYESL------------KQNLGHGSQPSFSLSFLAGVMAGTVAAIVTTPFDVVK 350
            |.:|::.:.:..:|..            :.:...|.|  ..::|.||.:||...|:|:.|.|||.
  Fly   223 RQIPYTMMKFACFERTVELLYKYVVPKPRADCTKGEQ--LIVTFAAGYIAGVFCAVVSHPADVVV 285

  Fly   351 THEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAI 409
            :......|...|                   .:.::.|..|::.|..||::.:....|:
  Fly   286 SKLNQAKGASAI-------------------SVAKSLGFSGMWNGLTPRIIMIGTLTAL 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 27/104 (26%)
Mito_carr 230..321 CDD:278578 18/103 (17%)
Mito_carr 321..425 CDD:278578 20/90 (22%)
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 25/100 (25%)
Mito_carr <175..245 CDD:278578 13/70 (19%)
Mito_carr 260..338 CDD:278578 19/86 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2001521
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.