DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and slc25a40

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_989316.1 Gene:slc25a40 XenbaseID:XB-GENE-1003942 Length:341 Species:Xenopus tropicalis

Alignment Length:355 Identity:163/356 (46%)
Similarity:223/356 (63%) Gaps:38/356 (11%)


  Fly    88 IRPLQQVISACTGAMITACFMTPLDVIKTRMQSQQSP--AHKCFFYSNGLMDHLFASGPNGSELA 150
            |.|.||:|::..||::|:.|:|||||:|.|:|:|..|  ..|||.|.|||||||... .||:..|
 Frog    14 ITPSQQMIASSMGALLTSFFVTPLDVVKIRLQAQSKPFIKGKCFVYCNGLMDHLCLC-TNGNGKA 77

  Fly   151 SLRQRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYN 215
            ..|....|..:.||.::|.|:||:.:|||||.||||.|:|:|:|||..|:|.             
 Frog    78 WYRAPGHFRGTTDAFVQIIRNEGIKSLWSGLPPTLVMAVPATVIYFTCYDQL------------- 129

  Fly   216 KSQEPRHLEIRDTKKSLP---SVVPMMSGVTARICAVTVVSPIELVRTKMQAQRQTYAQMLQFVR 277
                 |.:.||    |:|   .:..:::|.|||:.:.|::||:||:|||||.:..:|.::.|.::
 Frog   130 -----RDILIR----SMPERAEIASLVAGATARLWSATLISPLELIRTKMQYRPLSYKELRQCIQ 185

  Fly   278 SVVALQGVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNL---GHGSQPSFSLSFLAGVMAGTVA 339
            |.||..|...||:|..||:|||||||.:||..||.:||:|   .:..||:|::||.||.::|::|
 Frog   186 SSVAKDGWLALWKGWGPTVLRDVPFSALYWHNYELVKQSLCQRYNTLQPTFAISFTAGAVSGSIA 250

  Fly   340 AIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVA 404
            ||||.|||||||..|:|.||..:||.|..|   ..||:..:..|...:|..|||||..|||:|||
 Frog   251 AIVTLPFDVVKTRRQVEVGELEMFTYSQKR---SSSTWKLMRAIVIENGFGGLFAGLIPRLIKVA 312

  Fly   405 PACAIMISTFEYSKSFFFHYNVRHHNEALL 434
            |||||||||:|:.||||...|    ||..|
 Frog   313 PACAIMISTYEFGKSFFRKLN----NERQL 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 58/121 (48%)
Mito_carr 230..321 CDD:278578 41/97 (42%)
Mito_carr 321..425 CDD:278578 57/104 (55%)
slc25a40NP_989316.1 Mito_carr 14..136 CDD:278578 61/145 (42%)
Solcar 1 14..132 59/137 (43%)
Solcar 2 140..224 38/84 (45%)
Mito_carr 143..225 CDD:278578 38/82 (46%)
Mito_carr 233..331 CDD:278578 57/101 (56%)
Solcar 3 234..328 54/97 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0761
Hieranoid 1 1.000
Homologene 1 1.000 H6040
Inparanoid 1 1.050 282 1.000 Inparanoid score I2684
OMA 1 1.010
OrthoDB 1 1.010 D1007936at2759
OrthoFinder 1 1.000 FOG0001348
OrthoInspector 1 1.000 T129256
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2199
TreeFam 1 0.960
1110.870

Return to query results.
Submit another query.