DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and slc25a39

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_956780.1 Gene:slc25a39 ZFINID:ZDB-GENE-040426-1250 Length:359 Species:Danio rerio

Alignment Length:366 Identity:156/367 (43%)
Similarity:224/367 (61%) Gaps:53/367 (14%)


  Fly    88 IRPLQQVISACTGAMITACFMTPLDVIKTRMQSQQSPAH-------------------KCFFYSN 133
            |.|:||::::.|||::|:.|:|||||:|.|:|:||:|..                   |||.|.|
Zfish    13 ITPVQQMLASGTGAVLTSLFVTPLDVVKIRLQAQQTPLFQAIAAESRPWFRVTRPSKWKCFLYCN 77

  Fly   134 GLMDHLFASGPNGSELASL-RQRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFV 197
            |||||::.. .|.|..::| :....||.:.||.:||:.:|||.:|||||.||||.|:|:|:|||.
Zfish    78 GLMDHVYVC-QNMSSCSNLYKTSTHFSGTLDAFVKITHNEGLRSLWSGLPPTLVMAVPATVIYFT 141

  Fly   198 AYEQFKARYLQIYESHYNKSQEPRHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKM 262
            .|:|.  |....|...|:...                 :|:::|..||:.||:|:||:|||||||
Zfish   142 CYDQL--RDFLCYSMGYHGDH-----------------IPLIAGGLARLGAVSVISPLELVRTKM 187

  Fly   263 QAQRQTYAQMLQFVRSVVALQGVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNL-GHGSQP--S 324
            |::|..|::::..:||.||..|...||||..||:|||||||.:||..||.:|..| .|...|  |
Zfish   188 QSRRLQYSELMVCIRSSVAQDGWLSLWRGWGPTVLRDVPFSALYWFNYELVKAQLCEHYRTPQAS 252

  Fly   325 FSLSFLAGVMAGTVAAIVTTPFDVVKTHEQIEFGER----VIFTDSPARDFGKKSTFSRLTGIYR 385
            |::||.||.::|.:||::|.|||||||..||:.||.    .:....|:      ||::.:..|:.
Zfish   253 FTISFTAGAVSGAIAAVLTLPFDVVKTRRQIQLGEMEALGAVSMKKPS------STWNMMRNIWI 311

  Fly   386 THGVRGLFAGCGPRLLKVAPACAIMISTFEYSKSFFFHYNV 426
            ..|.:|||||..||::|||||||:||||:|:.|:||...|:
Zfish   312 DMGYKGLFAGFLPRVIKVAPACAVMISTYEFGKTFFQERNL 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 60/139 (43%)
Mito_carr 230..321 CDD:278578 44/92 (48%)
Mito_carr 321..425 CDD:278578 49/110 (45%)
slc25a39NP_956780.1 Mito_carr 13..150 CDD:278578 60/140 (43%)
Solcar 1 13..149 60/139 (43%)
Solcar 2 157..241 42/101 (42%)
Mito_carr 163..246 CDD:278578 43/83 (52%)
Mito_carr 250..351 CDD:278578 48/107 (45%)
Solcar 3 251..346 46/101 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0761
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 278 1.000 Inparanoid score I2837
OMA 1 1.010
OrthoDB 1 1.010 D1007936at2759
OrthoFinder 1 1.000 FOG0001348
OrthoInspector 1 1.000 T128740
orthoMCL 1 0.900 OOG5_127938
Panther 1 1.100 O PTHR45760
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.