DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and Bmcp

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster

Alignment Length:329 Identity:84/330 (25%)
Similarity:132/330 (40%) Gaps:50/330 (15%)


  Fly   101 AMITACFMT-PLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWDA 164
            |.|||.|.| |:|..|||:|.|.....:.|                    :.||.|    ...||
  Fly    16 ASITAEFGTFPIDTTKTRLQIQGQKIDQSF--------------------SQLRYR----GMTDA 56

  Fly   165 LMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEI-RDT 228
            .:||||.|||.||:||:.|.::.......|.|..|...|            |....|.|.| .|.
  Fly    57 FVKISREEGLRALYSGIWPAVLRQATYGTIKFGTYYTLK------------KLANERGLLINEDG 109

  Fly   229 KKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQ-RQTYAQMLQFVRSVVALQGVWGLWRGL 292
            .:.:.|.:  :....|...:..:.:|.::::.:||.. :..:..:|.....:...:||.|||||:
  Fly   110 SERVWSNI--LCAAAAGAISSAIANPTDVLKVRMQVHGKGQHKGLLGCFGEIYKYEGVRGLWRGV 172

  Fly   293 RPTILRDVPFSGIYWPIYESLKQNLGHGSQPSFSLSFLAGVMAGTVAAIVTTPFDVVKTH----- 352
            .||..|.|..:.:..|:|:..|..|.:.........|::..:|...:||.:||.||::|.     
  Fly   173 GPTAQRAVVIASVELPVYDFCKLQLMNAFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQR 237

  Fly   353 -EQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFEY 416
             ..|.....|....:|....|   :........|..|:..|:.|..|..:::.|...|...|:|.
  Fly   238 PVSITMNGVVTAAATPKLYSG---SLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQ 299

  Fly   417 SKSF 420
            .|.:
  Fly   300 LKKY 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 35/107 (33%)
Mito_carr 230..321 CDD:278578 21/92 (23%)
Mito_carr 321..425 CDD:278578 23/107 (21%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 36/117 (31%)
Mito_carr <132..199 CDD:278578 19/67 (28%)
Mito_carr 204..303 CDD:278578 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2003221
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.