DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and CG18418

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster


Alignment Length:317 Identity:72/317 - (22%)
Similarity:127/317 - (40%) Gaps:68/317 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWD 163
            |..|:..|.:.|||::|||||                     .||..|:.        ::.:|::
  Fly    23 TSGMLATCIVQPLDLLKTRMQ---------------------ISGTLGTR--------EYKNSFE 58

  Fly   164 ALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDT 228
            .|.|:.::||:.:|::||...|:.....|......|:.    .|..|..::.             
  Fly    59 VLSKVLKNEGILSLYNGLSAGLLRQATYTSAKMGVYQM----ELDWYRKNFG------------- 106

  Fly   229 KKSLPSVVPMMS-GVTARICAVTVVSPIELVRTKMQA-------QRQTYAQMLQ-FVRSVVALQG 284
              :.||:|..|: |:.|........:|.|:...:|.:       .|:.|..:.. ||| :|..:|
  Fly   107 --NYPSMVASMTMGIVAGAFGAMCGNPAEVALIRMMSDNRLMPEDRRNYKNVGDAFVR-IVKDEG 168

  Fly   285 VWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGHG-SQPSFSLSFLAGVMAGTVAAIVTTPFDV 348
            |..||||..||:.|.:..:.:....|..:|..| || ......|...|.:::|.:.::.:.|.|:
  Fly   169 VVALWRGCLPTVGRAMVVNMVQLASYSLMKNQL-HGYLSEGIPLHLTAALVSGLLTSVTSMPLDM 232

  Fly   349 VKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAP 405
            .||..|    :..:....|.    ...|...|..:.:..|...::.|..|.|:::.|
  Fly   233 AKTRIQ----QMKVIDGKPE----YSGTIDVLKKVLKNEGAFAVWKGFTPYLMRMGP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 25/107 (23%)
Mito_carr 230..321 CDD:278578 29/100 (29%)
Mito_carr 321..425 CDD:278578 16/85 (19%)
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 27/132 (20%)
PTZ00169 18..296 CDD:240302 72/317 (23%)
Mito_carr 109..205 CDD:278578 29/97 (30%)
Mito_carr 208..300 CDD:278578 16/82 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.