DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and CG18418

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_647924.2 Gene:CG18418 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster

Alignment Length:317 Identity:72/318 (23%)
Similarity:127/318 (40%) Gaps:68/318 (21%)


  Fly    99 TGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWD 163
            |..|:..|.:.|||::|||||                     .||..|:.        ::.:|::
  Fly    23 TSGMLATCIVQPLDLLKTRMQ---------------------ISGTLGTR--------EYKNSFE 58

  Fly   164 ALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDT 228
            .|.|:.::||:.:|::||...|:.....|......|:.    .|..|..::.             
  Fly    59 VLSKVLKNEGILSLYNGLSAGLLRQATYTSAKMGVYQM----ELDWYRKNFG------------- 106

  Fly   229 KKSLPSVVPMMS-GVTARICAVTVVSPIELVRTKMQA-------QRQTYAQMLQ-FVRSVVALQG 284
              :.||:|..|: |:.|........:|.|:...:|.:       .|:.|..:.. ||| :|..:|
  Fly   107 --NYPSMVASMTMGIVAGAFGAMCGNPAEVALIRMMSDNRLMPEDRRNYKNVGDAFVR-IVKDEG 168

  Fly   285 VWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGHG-SQPSFSLSFLAGVMAGTVAAIVTTPFDV 348
            |..||||..||:.|.:..:.:....|..:|..| || ......|...|.:::|.:.::.:.|.|:
  Fly   169 VVALWRGCLPTVGRAMVVNMVQLASYSLMKNQL-HGYLSEGIPLHLTAALVSGLLTSVTSMPLDM 232

  Fly   349 VKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAP 405
            .||..|    :..:....|.    ...|...|..:.:..|...::.|..|.|:::.|
  Fly   233 AKTRIQ----QMKVIDGKPE----YSGTIDVLKKVLKNEGAFAVWKGFTPYLMRMGP 281

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 25/108 (23%)
Mito_carr 230..321 CDD:278578 29/101 (29%)
Mito_carr 321..425 CDD:278578 16/86 (19%)
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 27/133 (20%)
PTZ00169 18..296 CDD:240302 72/318 (23%)
Mito_carr 109..205 CDD:278578 29/98 (30%)
Mito_carr 208..300 CDD:278578 16/83 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2002756
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.