| Sequence 1: | NP_001287212.1 | Gene: | CG2616 / 40915 | FlyBaseID: | FBgn0037512 | Length: | 449 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001246615.1 | Gene: | PMP34 / 38532 | FlyBaseID: | FBgn0052250 | Length: | 314 | Species: | Drosophila melanogaster |
| Alignment Length: | 338 | Identity: | 82/338 - (24%) |
|---|---|---|---|
| Similarity: | 143/338 - (42%) | Gaps: | 73/338 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 95 ISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFS 159
Fly 160 SSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLE 224
Fly 225 IRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQ---------RQTYAQMLQFVRSVV 280
Fly 281 ALQGVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGH---GSQPSFSLSFLAGVMAGTVAAIV 342
Fly 343 TTPFDVVKTHEQIEFGERVIFTDS-PARDFGK----KSTFSRLTGIYRTHGVRGLFAGCGPRLLK 402
Fly 403 VAPACAIMISTFE 415 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG2616 | NP_001287212.1 | Mito_carr | 86..207 | CDD:278578 | 26/111 (23%) |
| Mito_carr | 230..321 | CDD:278578 | 22/102 (22%) | ||
| Mito_carr | 321..425 | CDD:278578 | 28/100 (28%) | ||
| PMP34 | NP_001246615.1 | Mito_carr | 15..96 | CDD:278578 | 24/107 (22%) |
| Mito_carr | 105..202 | CDD:278578 | 26/110 (24%) | ||
| Mito_carr | 214..303 | CDD:278578 | 26/93 (28%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45441474 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||