DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and Tyler

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_608327.2 Gene:Tyler FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster

Alignment Length:437 Identity:183/438 (42%)
Similarity:246/438 (56%) Gaps:73/438 (17%)


  Fly    46 SGGTSGGNNLKPERSAREDDAINRLTDSKSSHRKLLSDPRFQIRPLQQVISACTGAMITACFMTP 110
            :||...|..|:    .:|.|.: |||.     ..|.:|||::|:|:|||:||..|.:||...:||
  Fly    11 NGGEEEGCRLE----CKEMDPL-RLTT-----LILSADPRYRIKPMQQVVSALVGGLITTFVVTP 65

  Fly   111 LDVIKTRMQSQ----QSP--AHKCFFYSNGLMDHLFAS--------GPNGSELASLRQRPQFSSS 161
            |:|:|||:|:|    |.|  :..|:.|.||||.|:..|        |.:...|..||      .:
  Fly    66 LEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPKPGRDPQNLRPLR------GA 124

  Fly   162 WDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIY------ESHYNKSQEP 220
            .||.:||....|.:.||:||.||||||||||||||:.||..|.....||      |....|.|.|
  Fly   125 MDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVSQKFEESGMKDQVP 189

  Fly   221 ------------RHLEIRDT----KKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQRQTY 269
                        |.:.:..|    ..|||..|||.||:.:|...||.::|||:||.|||::..||
  Fly   190 GADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTAITPIEMVRIKMQSEYMTY 254

  Fly   270 AQMLQFVRSVVALQGVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGHGSQPSFSLSFLAGVM 334
            |::.:.:||::...|:.|||||..||::||.||||.||.:||::|:... .::|:|..|||.|.:
  Fly   255 AELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIKRAFS-VTEPTFLFSFLTGAI 318

  Fly   335 AGTVAAIVTTPFDVVKTHEQIEFGERVIF--------------------TDSPARDFGKKSTFSR 379
            :|.||..||.|||::.||.|||.|:.|::                    |...|....:.|..||
  Fly   319 SGAVATFVTMPFDLITTHTQIELGQDVLYEEIGAGTGAGTGTGAGARPKTPQSAVANSRPSVLSR 383

  Fly   380 LTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFEYSKSFFFHYNV 426
            :..|||..|||||:.|..||:|:|.|||||||||||||||||||||:
  Fly   384 MRQIYRLQGVRGLYVGVMPRMLRVVPACAIMISTFEYSKSFFFHYNL 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 59/135 (44%)
Mito_carr 230..321 CDD:278578 43/91 (47%)
Mito_carr 321..425 CDD:278578 59/124 (48%)
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 59/136 (43%)
Mito_carr 216..302 CDD:278578 43/86 (50%)
Mito_carr 306..429 CDD:278578 59/123 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130797924
eggNOG 1 0.900 E1_KOG0761
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 149 1.000 Inparanoid score I1669
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001348
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45760
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.