DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and CG18324

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_725361.1 Gene:CG18324 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster

Alignment Length:329 Identity:85/330 (26%)
Similarity:136/330 (41%) Gaps:60/330 (18%)


  Fly    99 TGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWD 163
            |.||....|..|:||:|||||.|...|.:                  |:.:...|..||      
  Fly    11 TAAMGAVVFTNPIDVVKTRMQLQGELAAR------------------GTYVKPYRHLPQ------ 51

  Fly   164 ALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDT 228
            |:::|..::||.||..||.|.|            .| ||....:::  |.|:.:.|..:|:..| 
  Fly    52 AMLQIVLNDGLLALEKGLAPAL------------CY-QFVLNSVRL--SVYSNALELGYLQNAD- 100

  Fly   229 KKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQ---------RQTYAQMLQFVRSVVALQG 284
             .|:.....|..|...........||..:::.:..||         :..:..|:..:..:....|
  Fly   101 -GSISFYRGMFFGALGGCTGTYFASPFYMIKAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNG 164

  Fly   285 VWGLWRGLRPTILRDVPFSGIY---WPIYESLKQNLGHGSQPSFSLSFLAGVMAGTVAAIVTTPF 346
            :.|.||...|::.|.:..|.:.   :|..:||.::.|..:.|.. |||.||:.:||:.|:..:||
  Fly   165 ISGFWRAALPSLNRTLVASSVQIGTFPKAKSLLKDKGWITHPVL-LSFCAGLSSGTLVAVANSPF 228

  Fly   347 DVVKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMI 411
            ||:.|.   .:.:.|   |...|....|......|.|:||.|:.|::.|..|...:.||...:..
  Fly   229 DVLTTR---MYNQPV---DEKGRGLMYKGLVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLTF 287

  Fly   412 STFE 415
            ..||
  Fly   288 VFFE 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 31/108 (29%)
Mito_carr 230..321 CDD:278578 19/103 (18%)
Mito_carr 321..425 CDD:278578 30/96 (31%)
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 32/115 (28%)
PTZ00169 5..293 CDD:240302 85/330 (26%)
Mito_carr 101..201 CDD:278578 18/100 (18%)
Mito_carr 204..296 CDD:278578 30/96 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2000418
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.