DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and Slc25a39

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001019963.1 Gene:Slc25a39 RGDID:1306193 Length:359 Species:Rattus norvegicus

Alignment Length:371 Identity:162/372 (44%)
Similarity:210/372 (56%) Gaps:60/372 (16%)


  Fly    88 IRPLQQVISACTGAMITACFMTPLDVIKTRMQSQ--------------------------QSPAH 126
            |.||||::::..||::|:.|||||||:|.|:|||                          |||. 
  Rat     9 ISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPTVASELTTPSRFWSLSYTKSPSTLQSPG- 72

  Fly   127 KCFFYSNGLMDHLFASGPNGSELASLRQRP-QFSSSWDALMKISRHEGLAALWSGLGPTLVSALP 190
            ||..|.||:::.|:.. |||:..|:..|.| :|:.:.||.:||.||||...|||||..|||..:|
  Rat    73 KCLLYCNGVLEPLYLC-PNGTRCATWFQDPTRFTGTLDAFVKIVRHEGTRTLWSGLPATLVMTVP 136

  Fly   191 STIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDTKKSLPS--VVPMMSGVTARICAVTVVS 253
            :|.|||.||:|.|| :|                    ..:||.|  ..||::|..||:..|||||
  Rat   137 ATAIYFTAYDQLKA-FL--------------------CGQSLTSDLYAPMVAGALARMGTVTVVS 180

  Fly   254 PIELVRTKMQAQRQTYAQMLQFVRSVVALQGVW-GLWRGLRPTILRDVPFSGIYWPIYESLKQNL 317
            |:||||||:|||..:|.::...|::.|| ||.| .||.|..||.|||||||.:||..||.:|..|
  Rat   181 PLELVRTKLQAQHVSYRELAACVQAAVA-QGGWRSLWLGWGPTALRDVPFSALYWFNYELVKSQL 244

  Fly   318 G---HGSQPSFSLSFLAGVMAGTVAAIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKSTFSR 379
            .   ...|.|..:||:||.::|.|||.:|.|||||||..|:..|........|.|   ..||:..
  Rat   245 NGPRQKEQTSVGISFVAGGISGMVAATLTLPFDVVKTQRQMSLGAVEAMRVKPPR---VDSTWLL 306

  Fly   380 LTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFEYSKSFFFHYN 425
            |..|....|.||||||..||::|.||:|||||||:|:.||||...|
  Rat   307 LRRIQAESGTRGLFAGFLPRIIKAAPSCAIMISTYEFGKSFFHRLN 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 62/146 (42%)
Mito_carr 230..321 CDD:278578 48/97 (49%)
Mito_carr 321..425 CDD:278578 50/104 (48%)
Slc25a39NP_001019963.1 Mito_carr 9..152 CDD:278578 62/146 (42%)
Solcar 1 9..151 62/145 (43%)
Solcar 2 159..243 45/85 (53%)
Mito_carr 161..246 CDD:278578 45/86 (52%)
Solcar 3 253..347 47/97 (48%)
Mito_carr 254..350 CDD:278578 49/99 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0761
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 262 1.000 Inparanoid score I2957
OMA 1 1.010
OrthoDB 1 1.010 D1007936at2759
OrthoFinder 1 1.000 FOG0001348
OrthoInspector 1 1.000 T131233
orthoMCL 1 0.900 OOG5_127938
Panther 1 1.100 O PTHR45760
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1110.840

Return to query results.
Submit another query.