DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and Dic3

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster

Alignment Length:361 Identity:73/362 (20%)
Similarity:130/362 (36%) Gaps:96/362 (27%)


  Fly    74 KSSHRKLLSDPRFQIRPLQQVISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDH 138
            :.|.|:|   ||:...      ..|....:|...  |:|:||.::|:|.....|..         
  Fly     3 EDSSRRL---PRWWFG------GVCAAIAVTGTH--PIDLIKVQLQTQSQADRKTV--------- 47

  Fly   139 LFASGPNGSELASLRQRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFK 203
                   |..|..:.:|                .|:...::|:..:....|..|...|..||..|
  Fly    48 -------GEILKGIHER----------------SGILGFYNGISASWFRQLTYTTTRFALYEAGK 89

  Fly   204 ARYLQIYESHYNKSQEPRHLEIRDTKK-SLPSVVPMMSGVTARICAVTVVSPIELVRTKMQ---- 263
                                :..||:| |....:...:|:...|..|    |.::|..::|    
  Fly    90 --------------------DYVDTQKVSSKMALATFAGIVGGIVGV----PGDVVTVRLQNDVK 130

  Fly   264 ---AQRQTYAQMLQFVRSVVALQGVWGLWRGLRPTILRDVPFSGIYWPIYESLKQ--NLGHGSQP 323
               .:|:.|..:...:..:...:||..|:||..|.:.|.|..:......|:.:||  .:..|:..
  Fly   131 LPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAGE 195

  Fly   324 SFSLSFLAGVMAGTVAAIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHG 388
            ...|.|....:||.:|.::|.|.||:||          .|.::      :...||.:.|.:.:..
  Fly   196 GVPLHFATSTIAGCIAVVITQPLDVIKT----------TFMNA------QPGEFSGIGGAFLSTA 244

  Fly   389 VRG---LFAGCGPRLLKVAPACAIMISTFEYSKSFF 421
            .:|   .:.|..|.|::|:|...|....:|.::..|
  Fly   245 KQGPLAFYKGFIPALIRVSPNTIITFVLYEQARMRF 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 20/121 (17%)
Mito_carr 230..321 CDD:278578 22/101 (22%)
Mito_carr 321..425 CDD:278578 24/105 (23%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 67/340 (20%)
Mito_carr 15..91 CDD:278578 20/136 (15%)
Mito_carr 93..187 CDD:278578 23/98 (23%)
Mito_carr 200..281 CDD:278578 23/98 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1999771
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.