DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and CG4995

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster

Alignment Length:410 Identity:87/411 (21%)
Similarity:156/411 (38%) Gaps:106/411 (26%)


  Fly    67 INRLTDSKSSHRKLLSD--------------PRFQIRPLQQVISACTGAMITACFMTPLDVIKTR 117
            |.|:.:.|..:||..|:              |:..:..:..::....|.::.    .|.|.:|..
  Fly     7 IYRVNNDKDPYRKRGSEIGDIQLKATSETFSPKMVVDFVAGLLGGAAGVLVG----HPFDTVKVH 67

  Fly   118 MQSQ--QSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWDALMKISRHEGLAALWSG 180
            :|:.  ::|.:|..|       |.|         .::.||.:|         |..:.|:::...|
  Fly    68 LQTDDPRNPKYKGTF-------HCF---------RTIVQRDKF---------IGLYRGISSPMGG 107

  Fly   181 LGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDTKKSLPSVVPMMSGVTAR 245
            :|  ||:|:                ...:|.:....|.:|..|...           ..:|..|.
  Fly   108 IG--LVNAI----------------VFGVYGNVQRLSNDPNSLTSH-----------FFAGSIAG 143

  Fly   246 ICAVTVVSPIELVRTKMQAQRQT-----YAQMLQFVRSVVALQGVWGLWRGLRPTILRDVPFSGI 305
            :....|.:|:||.:|::|...|.     :...:..::.:|..:|:.|.::||..|||||:|....
  Fly   144 VAQGFVCAPMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFAS 208

  Fly   306 YWPIYESLKQNLGHGSQPSFSLSFLAGVMAGTVAAIVTTPFDVVKTHEQIE-FGERVI---FTDS 366
            |:..:|.|.:.:   ..|..:.:.:||..||..:.:...|.||||||.|.: .|....   |.|.
  Fly   209 YFVSFEYLMRQV---ETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDC 270

  Fly   367 PARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAP---ACAIMIS-TFEYSKSFFFHYNVR 427
            ..:.|             |..|.:..|.|....|::..|   ||..::| ..:...:.....:|.
  Fly   271 AMKGF-------------RNEGPQYFFRGLNSTLIRAFPMNAACFFVVSWVLDICNAKGGMDSVM 322

  Fly   428 HHNEALL---LDNPKDTTVE 444
            |.::.|.   |||.....:|
  Fly   323 HSDQPLTLVNLDNKSQADLE 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 20/123 (16%)
Mito_carr 230..321 CDD:278578 23/96 (24%)
Mito_carr 321..425 CDD:278578 26/112 (23%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 22/136 (16%)
PTZ00169 41..295 CDD:240302 69/328 (21%)
Mito_carr 128..218 CDD:278578 25/101 (25%)
Mito_carr 221..304 CDD:278578 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1998381
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.