DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and CG9582

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster

Alignment Length:344 Identity:90/345 (26%)
Similarity:147/345 (43%) Gaps:68/345 (20%)


  Fly    92 QQVISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRP 156
            |.:....:|.:...|| .||||:|||||.|  .||                 |.|.|:.      
  Fly    16 QFLAGGLSGFIEIICF-HPLDVVKTRMQIQ--GAH-----------------PFGGEVV------ 54

  Fly   157 QFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPR 221
             ::...||::||.|:|||::||.|:.|.:....|.....|:.||..|. |.|.            
  Fly    55 -YTCPLDAIVKIYRYEGLSSLWKGIVPPICVETPKRGGKFLMYESLKP-YFQF------------ 105

  Fly   222 HLEIRDTKKSLPSVVPM---MSGVTARICAVTVVSPIELVRTKMQAQRQTYAQMLQFVRSVVALQ 283
                     ..|...|:   |||..|.|....:|:|.|:|:...||.|....:.|..|:.::...
  Fly   106 ---------GAPQPTPLTHAMSGSMAAILESFLVNPFEVVKITQQAHRGKRLKTLSVVKYIIKHD 161

  Fly   284 --GVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGHGSQPSFSL---SFLAGVMAGTVAAIVT 343
              |:.||:||:...:.|:..|...::..|.:||..:......::::   ..:|| :|.::|.:::
  Fly   162 GYGIKGLYRGITALVARNAVFHFGFFGFYNALKDIVPSPEDKTYNILRKVIIAG-LASSLACVMS 225

  Fly   344 TPFDVVKTHEQIEFGERVIFTDSPARDFGK-KSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPAC 407
            ...|:.|...|         ...|.:...| :.|.|.:...::..|.|.||.|.|..:|:|.|..
  Fly   226 VTLDMAKCRIQ---------GPQPVKGEVKYQWTISTIKSTFKEEGFRSLFKGLGAMILRVGPGG 281

  Fly   408 AIMISTFEYSKSFFFHYNV 426
            |:::.|:||...|....|:
  Fly   282 AMLLVTYEYLFEFLKSQNI 300

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 37/115 (32%)
Mito_carr 230..321 CDD:278578 26/96 (27%)
Mito_carr 321..425 CDD:278578 25/108 (23%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 88/338 (26%)
Mito_carr 17..104 CDD:278578 36/115 (31%)
Mito_carr 109..196 CDD:278578 25/87 (29%)
Mito_carr 216..295 CDD:278578 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1989254
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.