DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2616 and Ucp4B

DIOPT Version :9

Sequence 1:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster


Alignment Length:344 Identity:84/344 - (24%)
Similarity:135/344 - (39%) Gaps:77/344 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 SACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELAS-LRQRPQFS 159
            |||:..::.    .|.|:.|||||.|                         .|:|| :.|:.::.
  Fly    46 SACSAEIVG----YPFDMCKTRMQIQ-------------------------GEIASRVGQKAKYR 81

  Fly   160 SSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLE 224
            ......|.|.|.|||..|:.|:...|......:.|..:.|:..:.:.:               :.
  Fly    82 GLLATAMGIVREEGLLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMI---------------VP 131

  Fly   225 IRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQRQTYAQ--------MLQFVRSVVA 281
            ..|.:..|..:...:|||.|...|..:.:|.||::.:||.:.|...:        :||.:.|:..
  Fly   132 DEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQMEGQRRLRGEPPRIHNVLQALTSIYR 196

  Fly   282 LQGVWGLWRGLRPTILRD--VPFSGIYWPIYESLKQNLGHGSQPSFSL------SFLAGVMAGTV 338
            ..||.|||:|..|...|.  |....:  ..|:..|:.|    ...|.|      .|:|.:.||..
  Fly   197 TGGVVGLWKGTVPNTWRSALVTIGDV--SCYDFCKRFL----IAEFDLVDNREVQFVAAMTAGVA 255

  Fly   339 AAIVTTPFDVVKTHEQIEFGERVIF--TDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLL 401
            .||::.|.||||:        |::.  ||...|....|.:...|:.:.|..|...::.|..|..:
  Fly   256 DAILSLPADVVKS--------RIMNQPTDEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWM 312

  Fly   402 KVAPACAIMISTFEYSKSF 420
            :|.||..:...|||..:.|
  Fly   313 RVGPASVVFWMTFEQIRRF 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 26/111 (23%)
Mito_carr 230..321 CDD:278578 27/100 (27%)
Mito_carr 321..425 CDD:278578 30/108 (28%)
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 75/317 (24%)
Mito_carr 32..129 CDD:278578 26/111 (23%)
Mito_carr 138..233 CDD:278578 27/100 (27%)
Mito_carr 246..331 CDD:278578 27/92 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441425
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.