DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and Rim2

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster

Alignment Length:381 Identity:101/382 (26%)
Similarity:152/382 (40%) Gaps:122/382 (32%)


  Fly   100 GAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNG--SELASLRQR------- 155
            ||::|.    ||:|:|||:||..:     |...:.|.::......||  |||....||       
  Fly    22 GAVVTC----PLEVVKTRLQSSTA-----FMTPSRLAENAGGGPANGGQSELLRPEQRRKLSTTI 77

  Fly   156 ------PQFSSSWDALMKIS------------------RH----EGLAALWSGLGPTLVSALPST 192
                  ||.......:|.||                  ||    ||..||:.||||.||...||.
  Fly    78 LRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAPSR 142

  Fly   193 IIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDTKKSLPS---------VVPMMSGVTARICA 248
            .|||..|.|                          ||.:|.|         :|.:||..:|...:
  Fly   143 AIYFCTYSQ--------------------------TKNTL
NSLGFVERDSPLVHIMSAASAGFVS 181

  Fly   249 VTVVSPIELVRTKMQAQRQTYAQML--QFVRSVVALQGVWGLWRGLRPTILRDVPFSGI-----Y 306
            .|..:||..|:|:||....:..||.  |.:..|.|..||...::|:..:      :.||     :
  Fly   182 STATNPIWFVKTRMQLDYNSKVQMTVRQCIERVYAQGGVAAFYKGITAS------YFGICETMVH 240

  Fly   307 WPIYESLK------QNLGH----GSQPSFSLSFLAGVMAGTVAAIVTTPFDVVKTHEQIEFGERV 361
            :.|||.:|      :|..|    ||: .|....:||.::.|:|:.:..|.:|.:|.         
  Fly   241 FVIYEFIKSKLLEQRNQRHTDTKGSR-DFLEFMMAGAVSKTIASCIAYPHEVARTR--------- 295

  Fly   362 IFTDSPARDFGKK--STFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFE 415
                  .|:.|.|  |.:..|..:::..|..||:.|...:|::..|..|||::|:|
  Fly   296 ------LREEGNKYNSFWQTLHTVWKEEGRAGLYRGLATQLVRQIPNTAIMMATYE 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 44/144 (31%)
Mito_carr 230..321 CDD:278578 30/117 (26%)
Mito_carr 321..425 CDD:278578 25/98 (26%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 46/169 (27%)
Mito_carr 163..253 CDD:278578 25/96 (26%)
Mito_carr 268..355 CDD:278578 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1998567
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.